F184149

General Info

Members Datasets Scaffolds Average Seq Length
141 114 99 196

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2554235005|2554258686
Length 232
Sequence TGTTTDIAVNTTTATTPETALDTTPETTATAQETALPTASAEQPLRLAVIVGSNREGRFAPVITDWFVSRARQRADFRVDVLDLAGTDLPTSLSYDPPPAVRAELAKVSPLLAAADAFVVLTPEYNHSYPAALKNLIDWHYSEWQAKPVAFVSYGGISGGLRAVEHLRQVFAELHAVTVRDTVSFPNAGGLFDDDGLKDPIGPDGAAKKMLDQLGWWARALRTARTAHPYAG

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
3 2643221593 Lysobacter sp. Root690 Isolate Unclassified
4 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
5 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
6 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
7 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
8 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
9 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
10 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
11 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
12 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
13 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
14 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
15 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
16 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
17 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
18 2867428634 Streptomyces sp. RP5T Isolate Unclassified
19 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
20 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
21 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
22 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
23 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
24 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
25 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
26 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
27 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
28 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
29 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
30 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
31 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
32 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
33 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
34 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
62 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
65 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
70 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
71 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
72 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
73 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
74 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
75 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
76 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
77 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
78 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
79 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
86 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
91 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
92 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
93 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
94 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
108 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
109 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
110 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
111 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
112 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
113 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
114 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.21
Metatranscriptomes 0
Isolates 29.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.77
Nodule 2.13
Rhizoplane 3.55
Rhizosphere 56.03
Stem 0
Stem Tuber 0
Unclassified 25.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1018530 3300002774 Bacteria 1106
2 JGI25151J46595_10000187 3300003187 Bacteria 76949
3 JGI25151J46595_10000458 3300003187 Bacteria 39262
4 JGI25151J46595_10000628 3300003187 Bacteria 30686
5 JGI25151J46595_10052057 3300003187 Bacteria 1380
6 JGI25153J46596_10035916 3300003215 Bacteria 1597
7 JGI25160J50197_1001410 3300003354 Bacteria 12049
8 Ga0070668_100000361 3300005347 Bacteria 30090
9 Ga0070667_100126479 3300005367 Bacteria 2227
10 Ga0070714_100017580 3300005435 Bacteria 5795
11 Ga0070665_100362314 3300005548 Bacteria 1456
12 Ga0068864_100104261 3300005618 Bacteria 2519
13 Ga0068851_10204497 3300005834 Bacteria 1103
14 Ga0068863_100058058 3300005841 Bacteria 3662
15 Ga0081455_10049458 3300005937 Bacteria 3624
16 Ga0070716_100041995 3300006173 Bacteria 2551
17 Ga0105247_10281261 3300009101 Bacteria 1148
18 Ga0105033_104775 3300009986 Bacteria 1159
19 Ga0163163_10102299 3300014325 Bacteria 2888
20 Ga0182008_10060279 3300014497 Bacteria 1871
21 Ga0207425_1001750 3300025245 Bacteria 8485
22 Ga0209130_1000932 3300025284 Bacteria 23406
23 Ga0209025_1000006 3300025294 Bacteria 1153444
24 Ga0209025_1000099 3300025294 Bacteria 231353
25 Ga0209025_1000171 3300025294 Bacteria 160478
26 Ga0209758_1001602 3300025297 Bacteria 25857
27 Ga0209758_1002664 3300025297 Bacteria 17655
28 Ga0209758_1004292 3300025297 Bacteria 12018
29 Ga0209758_1005931 3300025297 Bacteria 9077
30 Ga0207426_1000065 3300025302 Bacteria 353625
31 Ga0207426_1025263 3300025302 Bacteria 2003
32 Ga0207665_10476636 3300025939 Bacteria 961
33 Ga0207711_10325091 3300025941 Bacteria 1422
34 Ga0207668_10935441 3300025972 Bacteria 773
35 Ga0307515_10028646 3300028794 Bacteria 9456
36 Ga0307511_10072592 3300030521 Bacteria 2498
37 Ga0307518_10038339 3300031838 Bacteria 3484
38 Ga0307414_10054365 3300032004 Bacteria 2798
39 Ga0373956_0002369 3300035119 Bacteria 7714
40 Ga0439436_0000875 3300041404 Bacteria 8233
41 Ga0439436_0024810 3300041404 Bacteria 1767
42 Ga0451853_2611522 3300041512 Bacteria 3890
43 Ga0439433_0006715 3300041999 Bacteria 2477
44 Ga0439448_0008167 3300042005 Bacteria 3057
45 Ga0439448_0038850 3300042005 Bacteria 1533
46 Ga0439449_0009007 3300042007 Bacteria 3786
47 Ga0439455_0006625 3300042012 Bacteria 2414
48 Ga0439455_0123185 3300042012 Bacteria 727
49 Ga0439457_003160 3300042014 Bacteria 4544
50 Ga0439462_0030567 3300042015 Bacteria 1425
51 Ga0450894_000519 3300042131 Bacteria 6576
52 Ga0450898_082423 3300042134 Bacteria 655
53 Ga0450903_000256 3300042138 Bacteria 11711
54 Ga0450903_001126 3300042138 Bacteria 5052
55 Ga0439458_0000099 3300042157 Bacteria 16985
56 Ga0439458_0003109 3300042157 Bacteria 3948
57 Ga0450908_035123 3300042184 Bacteria 869
58 Ga0439464_0003291 3300042439 Bacteria 4064
59 Ga0466969_0011716 3300044656 Bacteria 4638
60 Ga0466972_0003823 3300044658 Bacteria 7488
61 Ga0466966_0222224 3300044684 Bacteria 1140
62 Ga0466961_0047642 3300044693 Bacteria 2740
63 Ga0466971_0197272 3300044719 Bacteria 949
64 Ga0466968_0087978 3300044735 Bacteria 1373
65 Ga0495583_0135943 3300046506 Bacteria 1026
66 Ga0495610_0023651 3300046512 Bacteria 3333
67 Ga0496104_0127031 3300048907 Bacteria 2449
68 Ga0496112_0145964 3300048915 Bacteria 2334
69 Ga0496113_0583249 3300048916 Bacteria 896
70 Ga0496117_0005838 3300048920 Bacteria 12746
71 Ga0496122_0000464 3300048925 Bacteria 84473
72 Ga0496122_0115874 3300048925 Bacteria 1744
73 Ga0496123_0000147 3300048926 Bacteria 143834
74 Ga0496124_0001440 3300048927 Bacteria 35173
75 Ga0496125_0002199 3300048928 Bacteria 26028
76 Ga0496125_0026879 3300048928 Bacteria 5227
77 Ga0496126_0000601 3300048929 Bacteria 67983
78 Ga0496126_0020743 3300048929 Bacteria 6433
79 Ga0496126_0116878 3300048929 Bacteria 2318
80 Ga0501032_0169182 3300049569 Bacteria 1433
81 Ga0501033_0032109 3300049570 Bacteria 3942
82 Ga0501034_0008202 3300049571 Bacteria 11071
83 Ga0501034_0037381 3300049571 Bacteria 4915
84 Ga0501034_0074823 3300049571 Bacteria 3394
85 Ga0501034_0641707 3300049571 Bacteria 964
86 Ga0501036_0000567 3300049572 Bacteria 26607
87 Ga0501036_0085948 3300049572 Bacteria 2659
88 Ga0501037_0026665 3300049573 Bacteria 4270
89 Ga0501038_0082970 3300049574 Bacteria 2698
90 Ga0501038_0154726 3300049574 Bacteria 1868
91 Ga0501043_0471830 3300049579 Bacteria 940
92 Ga0501047_0021022 3300049581 Bacteria 6269
93 Ga0501047_0057898 3300049581 Bacteria 3746
94 Ga0501070_0009031 3300049586 Bacteria 8432
95 Ga0501035_0035957 3300049822 Bacteria 4492
96 Ga0501044_0000165 3300049823 Bacteria 82268
97 Ga0501044_0006098 3300049823 Bacteria 13299
98 Ga0501044_0432185 3300049823 Bacteria 1225
99 Ga0466962_0046143 3300061719 Bacteria 2082

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2862382967 2862384431 163
2 3300041404 Ga0439436_0024810 Ga0439436_0024810_1077_1631 181
3 3300042014 Ga0439457_003160 Ga0439457_003160_271_825 181
4 3300042134 Ga0450898_082423 Ga0450898_082423_14_574 182
5 iso_pu_bacteria 8056447290 8056449710 182
6 3300046506 Ga0495583_0135943 Ga0495583_0135943_350_919 185
7 iso_pu_bacteria 2891373044 2891373546 185
8 iso_pu_bacteria 2989349275 2989350018 185
9 iso_pu_bacteria 2989771324 2989776039 185
10 iso_pu_bacteria 8054558443 8054561029 185
11 3300048907 Ga0496104_0127031 Ga0496104_0127031_566_1219 186
12 iso_pu_bacteria 2786546132 2786669441 186
13 iso_pu_bacteria 2786546132 2786674459 186
14 iso_pu_bacteria 2808606375 2808919635 186
15 iso_pu_bacteria 2844533157 2844535293 186
16 iso_pu_bacteria 2867312974 2867319037 186
17 iso_pu_bacteria 2867319477 2867324601 186
18 iso_pu_bacteria 2867428634 2867435022 186
19 iso_pu_bacteria 2884693830 2884700181 186
20 iso_pu_bacteria 2895442618 2895450597 186
21 iso_pu_bacteria 2923516293 2923517271 186
22 iso_pu_bacteria 2954380949 2954387227 186
23 iso_pu_bacteria 2954673503 2954680945 186
24 iso_pu_bacteria 2954682443 2954683212 186
25 iso_pu_bacteria 3002998708 3003003645 186
26 iso_pu_bacteria 8025478263 8025482264 186
27 iso_pu_bacteria 8053945823 8053948061 186
28 iso_pu_bacteria 8056667051 8056673071 186
29 3300025972 Ga0207668_10935441 Ga0207668_109354411 187
30 3300028794 Ga0307515_10028646 Ga0307515_100286465 187
31 3300042005 Ga0439448_0038850 Ga0439448_0038850_13_594 187
32 3300042012 Ga0439455_0006625 Ga0439455_0006625_1807_2388 187
33 3300042138 Ga0450903_000256 Ga0450903_000256_7717_8298 187
34 3300042157 Ga0439458_0003109 Ga0439458_0003109_1490_2071 187
35 iso_pu_bacteria 2600255389 2602009406 187
36 iso_pu_bacteria 2643221593 2643973262 187
37 iso_pu_bacteria 2784746763 2785344418 187
38 iso_pu_bacteria 2823421272 2823424738 187
39 iso_pu_bacteria 2919501602 2919504464 187
40 iso_pu_bacteria 2926063275 2926064963 187
41 iso_pu_bacteria 8048406513 8048411093 187
42 3300025297 Ga0209758_1002664 Ga0209758_10026646 188
43 3300025297 Ga0209758_1004292 Ga0209758_10042927 188
44 3300025302 Ga0207426_1025263 Ga0207426_10252632 188
45 3300030521 Ga0307511_10072592 Ga0307511_100725922 188
46 3300041404 Ga0439436_0000875 Ga0439436_0000875_1493_2110 188
47 3300041512 Ga0451853_2611522 Ga0451853_2611522_585_1208 188
48 3300041999 Ga0439433_0006715 Ga0439433_0006715_794_1411 188
49 3300042007 Ga0439449_0009007 Ga0439449_0009007_883_1500 188
50 3300042015 Ga0439462_0030567 Ga0439462_0030567_130_747 188
51 3300042131 Ga0450894_000519 Ga0450894_000519_5401_6036 188
52 3300042184 Ga0450908_035123 Ga0450908_035123_216_851 188
53 3300044658 Ga0466972_0003823 Ga0466972_0003823_5374_5964 188
54 3300044684 Ga0466966_0222224 Ga0466966_0222224_167_769 188
55 3300044735 Ga0466968_0087978 Ga0466968_0087978_137_727 188
56 3300049571 Ga0501034_0008202 Ga0501034_0008202_5099_5722 188
57 3300049572 Ga0501036_0000567 Ga0501036_0000567_21566_22252 188
58 3300049574 Ga0501038_0154726 Ga0501038_0154726_842_1528 188
59 iso_pu_bacteria 2554235005 2554258686 188
60 iso_pu_bacteria 2863404153 2863405665 188
61 iso_pu_bacteria 2954002825 2954003842 188
62 iso_pu_bacteria 2990059506 2990060839 188
63 iso_pu_bacteria 2996221748 2996222387 188
64 iso_pu_bacteria 8008558824 8008559394 188
65 3300003187 JGI25151J46595_10052057 JGI25151J46595_100520572 189
66 3300005367 Ga0070667_100126479 Ga0070667_1001264791 189
67 3300005435 Ga0070714_100017580 Ga0070714_1000175805 189
68 3300005548 Ga0070665_100362314 Ga0070665_1003623142 189
69 3300005618 Ga0068864_100104261 Ga0068864_1001042612 189
70 3300005841 Ga0068863_100058058 Ga0068863_1000580583 189
71 3300006173 Ga0070716_100041995 Ga0070716_1000419953 189
72 3300009101 Ga0105247_10281261 Ga0105247_102812612 189
73 3300014325 Ga0163163_10102299 Ga0163163_101022993 189
74 3300025294 Ga0209025_1000171 Ga0209025_100017178 189
75 3300025939 Ga0207665_10476636 Ga0207665_104766362 189
76 3300025941 Ga0207711_10325091 Ga0207711_103250913 189
77 3300031838 Ga0307518_10038339 Ga0307518_100383392 189
78 3300035119 Ga0373956_0002369 Ga0373956_0002369_4187_4771 189
79 3300042005 Ga0439448_0008167 Ga0439448_0008167_2204_2788 189
80 3300042012 Ga0439455_0123185 Ga0439455_0123185_85_669 189
81 3300042138 Ga0450903_001126 Ga0450903_001126_2196_2780 189
82 3300042157 Ga0439458_0000099 Ga0439458_0000099_880_1464 189
83 3300044656 Ga0466969_0011716 Ga0466969_0011716_3802_4407 189
84 3300044693 Ga0466961_0047642 Ga0466961_0047642_1526_2131 189
85 3300044719 Ga0466971_0197272 Ga0466971_0197272_85_690 189
86 3300048915 Ga0496112_0145964 Ga0496112_0145964_1307_1924 189
87 3300048916 Ga0496113_0583249 Ga0496113_0583249_76_693 189
88 3300048920 Ga0496117_0005838 Ga0496117_0005838_8771_9343 189
89 3300048925 Ga0496122_0000464 Ga0496122_0000464_54897_55469 189
90 3300048925 Ga0496122_0115874 Ga0496122_0115874_35_607 189
91 3300048926 Ga0496123_0000147 Ga0496123_0000147_46821_47393 189
92 3300048927 Ga0496124_0001440 Ga0496124_0001440_12648_13220 189
93 3300048928 Ga0496125_0002199 Ga0496125_0002199_650_1222 189
94 3300048929 Ga0496126_0000601 Ga0496126_0000601_45730_46302 189
95 3300048929 Ga0496126_0020743 Ga0496126_0020743_2298_2870 189
96 3300049569 Ga0501032_0169182 Ga0501032_0169182_320_892 189
97 3300049570 Ga0501033_0032109 Ga0501033_0032109_2705_3277 189
98 3300049571 Ga0501034_0037381 Ga0501034_0037381_2962_3534 189
99 3300049571 Ga0501034_0074823 Ga0501034_0074823_458_1030 189
100 3300049571 Ga0501034_0641707 Ga0501034_0641707_115_687 189
101 3300049572 Ga0501036_0085948 Ga0501036_0085948_1368_1940 189
102 3300049573 Ga0501037_0026665 Ga0501037_0026665_935_1507 189
103 3300049574 Ga0501038_0082970 Ga0501038_0082970_636_1208 189
104 3300049579 Ga0501043_0471830 Ga0501043_0471830_238_810 189
105 3300049581 Ga0501047_0057898 Ga0501047_0057898_2231_2827 189
106 3300049822 Ga0501035_0035957 Ga0501035_0035957_2982_3554 189
107 3300049823 Ga0501044_0432185 Ga0501044_0432185_121_693 189
108 3300061719 Ga0466962_0046143 Ga0466962_0046143_200_805 189
109 iso_pu_bacteria 2643221601 2644018550 189
110 iso_pu_bacteria 2643221631 2644177454 189
111 iso_pu_bacteria 2643221677 2644431697 189
112 iso_pu_bacteria 2818991472 2819741841 189
113 iso_pu_bacteria 2862178590 2862182620 189
114 iso_pu_bacteria 2918501144 2918503695 189
115 3300003187 JGI25151J46595_10000458 JGI25151J46595_100004583 190
116 3300003187 JGI25151J46595_10000628 JGI25151J46595_100006285 190
117 3300003354 JGI25160J50197_1001410 JGI25160J50197_10014108 190
118 3300005834 Ga0068851_10204497 Ga0068851_102044972 190
119 3300009986 Ga0105033_104775 Ga0105033_1047752 190
120 3300025284 Ga0209130_1000932 Ga0209130_10009328 190
121 3300025294 Ga0209025_1000099 Ga0209025_100009935 190
122 3300025297 Ga0209758_1001602 Ga0209758_10016027 190
123 3300025302 Ga0207426_1000065 Ga0207426_1000065165 190
124 3300046512 Ga0495610_0023651 Ga0495610_0023651_78_653 190
125 3300049823 Ga0501044_0006098 Ga0501044_0006098_9025_9639 190
126 3300002774 JGI25150J39212_1018530 JGI25150J39212_10185301 191
127 3300003187 JGI25151J46595_10000187 JGI25151J46595_1000018715 191
128 3300003215 JGI25153J46596_10035916 JGI25153J46596_100359162 191
129 3300005347 Ga0070668_100000361 Ga0070668_10000036111 191
130 3300005937 Ga0081455_10049458 Ga0081455_100494582 191
131 3300014497 Ga0182008_10060279 Ga0182008_100602793 191
132 3300025245 Ga0207425_1001750 Ga0207425_10017509 191
133 3300025294 Ga0209025_1000006 Ga0209025_1000006540 191
134 3300025297 Ga0209758_1005931 Ga0209758_10059316 191
135 3300032004 Ga0307414_10054365 Ga0307414_100543654 191
136 3300042439 Ga0439464_0003291 Ga0439464_0003291_3355_3933 191
137 3300048928 Ga0496125_0026879 Ga0496125_0026879_3416_4039 191
138 3300048929 Ga0496126_0116878 Ga0496126_0116878_100_723 191
139 3300049581 Ga0501047_0021022 Ga0501047_0021022_4029_4673 191
140 3300049586 Ga0501070_0009031 Ga0501070_0009031_7771_8415 191
141 3300049823 Ga0501044_0000165 Ga0501044_0000165_23476_24120 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

45

190

0.93

PF02525

Flavodoxin_2

Flavodoxin-like fold

46

164

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fzv-assembly1.cif.gz_B crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.8793 3 184
7ple-assembly1.cif.gz_C arsh of paracoccus denitrificans 0.8655 3 183
7f76-assembly1.cif.gz_A crystal structure of fmn-dependent nadph-quinone reductase (azor) from bacillus cohnii 0.8575 5 179
2fzv-assembly1.cif.gz_A crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.8561 5 190
2fzv-assembly1.cif.gz_D crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.8543 5 185
ID Description Score Start End Superfamily
af_Q54QT4_9_187_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8435 7 165 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8421 7 179 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8342 5 190 3.40.50.360
4c76B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8257 5 174 3.40.50.360
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8253 5 190 3.40.50.360
ID Description Score Start End GO Terms
AF-D3D4K4-F1-model_v4 NADPH-dependent FMN reductase 0.9929 71 183 GO:0005829
GO:0010181
GO:0016491
AF-A0A7Y6AH96-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9863 66 187 GO:0005829
GO:0010181
GO:0016491
AF-A0A6G3BSC3-F1-model_v4 NAD(FAD)-dependent dehydrogenase 0.9818 72 187 GO:0005829
GO:0010181
GO:0016491
AF-A0A7W7XQE4-F1-model_v4 deleted 0.9745 5 187
AF-A0A2T7J4A2-F1-model_v4 NADPH-dependent FMN reductase 0.9743 5 187 GO:0005829
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
92.04 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map