F183973

General Info

Members Datasets Scaffolds Average Seq Length
141 111 282 307

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0202110|Ga0501083_0202110_251_1285
Length 344
Sequence VAAPSEDYINASSLPSGGEAFFISFRHRELPPVIGAAVDLEVQLGRLVLPNPILVASGTFGYAREMAGFVELKRLGGVVPKTITKLPRPGNPPWRTVETTGGMLNSIGLDNDGIDYFLANHLPYLGSLGTPIVVSVAGRTQEEFVELAGMLSGRSEVAAVELNISCPNVSGGVDFGTDPAMCERVVAGCRGSCDRPIIAKLTPNVSNIAAVAKGAEAGGADALSVINTCLGMAVDWRRRKPLLGNVLGGLSGPAIKPIALRCVYQTAKTVQIPIIGIGGIATLDDVMEFLVAGATAVQLGTVNFYDPTVSIRVLDGLPDALRQLGASRAADVVGTLVAAAPQGK

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
9 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
12 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
13 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
14 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
15 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
16 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
17 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
23 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
25 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
26 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
27 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
28 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
29 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
30 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
31 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
32 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
33 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
34 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
35 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
36 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
37 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
38 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
39 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
40 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
41 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
42 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
43 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
44 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
45 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
46 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
47 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
48 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
49 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
50 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
51 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
52 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
53 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
54 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
55 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
56 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
57 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
58 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
59 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
60 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
61 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
62 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
63 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
64 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
65 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
66 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
75 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
76 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
78 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
79 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
80 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
81 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
82 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
83 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
84 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
85 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
86 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
87 2643221556 Massilia sp. Root1485 Isolate Unclassified
88 2643221580 Devosia sp. Root635 Isolate Unclassified
89 2643221674 Devosia sp. Root436 Isolate Unclassified
90 2643221684 Massilia sp. Root133 Isolate Unclassified
91 2643221693 Rhizobium sp. Root491 Isolate Unclassified
92 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
93 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
94 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
95 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
96 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
97 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
98 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
99 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
100 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
101 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
102 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
103 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
104 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
105 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
106 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
107 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
108 2932401849 Devosia sp. 2618 Isolate Rhizosphere
109 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
110 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
111 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.43
Metatranscriptomes 0
Isolates 20.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.51
Nodule 12.77
Rhizoplane 7.8
Rhizosphere 44.68
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0202110 3300049744 Bacteria 1296
2 Ga0055536_1009984 3300003781 Bacteria 3839
3 Ga0055540_1014917 3300003792 Bacteria 2289
4 Ga0055531_10000603 3300003794 Bacteria 31229
5 Ga0065712_10083339 3300005290 Bacteria 2845
6 Ga0070713_100351756 3300005436 Bacteria 1367
7 Ga0070665_100000297 3300005548 Bacteria 77862
8 Ga0068864_100358634 3300005618 Bacteria 1377
9 Ga0075369_10071511 3300006186 Bacteria 1527
10 Ga0075428_100016695 3300006844 Bacteria 8106
11 Ga0099826_10007624 3300006948 Bacteria 7996
12 Ga0105237_10001452 3300009545 Bacteria 31274
13 Ga0105239_10001463 3300010375 Bacteria 31403
14 Ga0171462_1031 3300013250 Bacteria 104981
15 Ga0213875_10003322 3300021388 Bacteria 9193
16 Ga0209758_1000203 3300025297 Bacteria 132184
17 Ga0209050_1006535 3300025298 Bacteria 6869
18 Ga0209051_1004065 3300025303 Bacteria 9219
19 Ga0209257_1001660 3300025304 Bacteria 25215
20 Ga0207671_10001161 3300025914 Bacteria 31406
21 Ga0207664_10135745 3300025929 Bacteria 2076
22 Ga0209282_1034142 3300027666 Bacteria 3093
23 Ga0268266_10001484 3300028379 Bacteria 27833
24 Ga0265338_10005032 3300028800 Bacteria 17461
25 Ga0265325_10000502 3300031241 Bacteria 28249
26 Ga0265339_10000299 3300031249 Bacteria 40398
27 Ga0265331_10000134 3300031250 Bacteria 96927
28 Ga0307513_10153178 3300031456 Bacteria 2210
29 Ga0265313_10000316 3300031595 Bacteria 52476
30 Ga0265314_10000413 3300031711 Bacteria 57497
31 Ga0265342_10006618 3300031712 Bacteria 8603
32 Ga0316574_0204212 3300035398 Unclassified 1269
33 Ga0395905_0000221 3300037471 Bacteria 87203
34 Ga0436364_0864678 3300037853 Bacteria 19504
35 Ga0436364_0908968 3300037853 Bacteria 1275
36 Ga0436364_1375735 3300037853 Bacteria 1161
37 Ga0400484_08800 3300038725 Bacteria 3513
38 Ga0400489_25925 3300039093 Unclassified 1551
39 Ga0436360_0722169 3300039438 Bacteria 1530
40 Ga0495651_0214413 3300046462 Bacteria 1337
41 Ga0495607_0000096 3300046501 Bacteria 92031
42 Ga0495643_0004578 3300046522 Bacteria 9628
43 Ga0495648_0005780 3300046524 Bacteria 10203
44 Ga0495665_0036698 3300046531 Bacteria 2616
45 Ga0495661_0000916 3300046665 Bacteria 27044
46 Ga0495661_0014266 3300046665 Bacteria 5325
47 Ga0495589_0126475 3300046794 Bacteria 1229
48 Ga0496100_0005172 3300048903 Bacteria 6997
49 Ga0496100_0010933 3300048903 Bacteria 5150
50 Ga0496101_0063024 3300048904 Bacteria 2697
51 Ga0496102_0000575 3300048905 Bacteria 39009
52 Ga0496103_0000658 3300048906 Bacteria 26129
53 Ga0496105_0189228 3300048908 Bacteria 1683
54 Ga0496106_0043075 3300048909 Bacteria 3386
55 Ga0496108_0040982 3300048911 Bacteria 3863
56 Ga0496112_0021985 3300048915 Bacteria 6071
57 Ga0496113_0048426 3300048916 Bacteria 3162
58 Ga0496115_0325380 3300048918 Bacteria 1257
59 Ga0496116_0001143 3300048919 Bacteria 31538
60 Ga0496116_0002287 3300048919 Bacteria 20319
61 Ga0496117_0001127 3300048920 Bacteria 40289
62 Ga0496117_0002886 3300048920 Bacteria 20840
63 Ga0496118_0001757 3300048921 Bacteria 31406
64 Ga0496119_0002254 3300048922 Bacteria 21451
65 Ga0496119_0061098 3300048922 Bacteria 2253
66 Ga0496120_0001307 3300048923 Bacteria 30979
67 Ga0496120_0011060 3300048923 Bacteria 6229
68 Ga0496121_0000482 3300048924 Bacteria 77205
69 Ga0496121_0003096 3300048924 Bacteria 24045
70 Ga0496121_0010622 3300048924 Bacteria 10343
71 Ga0496122_0001837 3300048925 Bacteria 32363
72 Ga0496122_0032820 3300048925 Bacteria 4284
73 Ga0496123_0001463 3300048926 Bacteria 32772
74 Ga0496124_0000921 3300048927 Bacteria 47487
75 Ga0496124_0001680 3300048927 Bacteria 31404
76 Ga0496125_0023835 3300048928 Bacteria 5641
77 Ga0496126_0005605 3300048929 Bacteria 14275
78 Ga0496126_0011106 3300048929 Bacteria 9356
79 Ga0496126_0062572 3300048929 Bacteria 3339
80 Ga0501033_0009610 3300049570 Bacteria 7442
81 Ga0501033_0190956 3300049570 Bacteria 1466
82 Ga0501034_0001334 3300049571 Bacteria 33320
83 Ga0501034_0001398 3300049571 Bacteria 32452
84 Ga0501034_0004329 3300049571 Bacteria 15833
85 Ga0501034_0028448 3300049571 Bacteria 5688
86 Ga0501034_0031724 3300049571 Bacteria 5367
87 Ga0501034_0036320 3300049571 Bacteria 4992
88 Ga0501034_0040774 3300049571 Bacteria 4698
89 Ga0501034_0043416 3300049571 Unclassified 4550
90 Ga0501034_0053924 3300049571 Bacteria 4048
91 Ga0501034_0237653 3300049571 Bacteria 1769
92 Ga0501036_0249087 3300049572 Bacteria 1489
93 Ga0501038_0226761 3300049574 Bacteria 1489
94 Ga0501039_0296919 3300049575 Bacteria 1270
95 Ga0501039_0399757 3300049575 Bacteria 1079
96 Ga0501042_0199222 3300049578 Bacteria 1444
97 Ga0501046_0012599 3300049580 Bacteria 7190
98 Ga0501047_0025955 3300049581 Bacteria 5634
99 Ga0501047_0268252 3300049581 Bacteria 1553
100 Ga0501070_0002267 3300049586 Bacteria 16908
101 Ga0501070_0068360 3300049586 Bacteria 2941
102 Ga0501075_0091697 3300049591 Bacteria 2306
103 Ga0501075_0227392 3300049591 Bacteria 1423
104 Ga0501083_0075675 3300049744 Bacteria 2236
105 Ga0501044_0010847 3300049823 Bacteria 9885
106 Ga0501044_0213424 3300049823 Bacteria 1883
107 Ga0501045_0127586 3300049824 Bacteria 1890
108 nmdc:mga0sz30_109515_c1 3300050516 Bacteria 1210
109 Ga0495601_0243497 3300053077 Bacteria 1174
110 Ga0500618_000657 3300053125 Bacteria 20576
111 Ga0500616_0000351 3300053153 Bacteria 65787
112 Ga0500634_0003488 3300053161 Bacteria 7009
113 2585281509 2582581308 Bacteria 7413247
114 2585993047 2585427633 Bacteria 6413184
115 2586003781 2585427634 Bacteria 6455027
116 2616312729 2615840626 Bacteria 7921970
117 2643799729 2643221556 Bacteria 7251154
118 2643913036 2643221580 Bacteria 3816678
119 2644411510 2643221674 Bacteria 3919126
120 2644474729 2643221684 Bacteria 7145183
121 2644520115 2643221693 Bacteria 5513853
122 2688393100 2687453341 Bacteria 6534136
123 2838678948 2838675328 Bacteria 4909118
124 2838717899 2838714209 Bacteria 5525906
125 2838723245 2838719591 Bacteria 5523910
126 2838728616 2838724970 Bacteria 4908691
127 2841849821 2841846520 Bacteria 5345850
128 2842128293 2842124991 Bacteria 5346824
129 2842133901 2842130223 Bacteria 4909145
130 2842155835 2842152218 Bacteria 4908957
131 2842174145 2842170452 Bacteria 5525737
132 2842179515 2842175837 Bacteria 4908771
133 2842191036 2842187318 Bacteria 5524014
134 2842215351 2842211629 Bacteria 5523832
135 2842228010 2842224351 Bacteria 5524473
136 2919118180 2919114240 Bacteria 5700270
137 2926757944 2926754445 Bacteria 5964435
138 2932405884 2932401849 Bacteria 4262978
139 2933010860 2933006813 Bacteria 4912075
140 2995396685 2995392953 Bacteria 4539380
141 2996314736 2996310559 Bacteria 6357320
142 Ga0501083_0202110
143 Ga0055536_1009984
144 Ga0055540_1014917
145 Ga0055531_10000603
146 Ga0065712_10083339
147 Ga0070713_100351756
148 Ga0070665_100000297
149 Ga0068864_100358634
150 Ga0075369_10071511
151 Ga0075428_100016695
152 Ga0099826_10007624
153 Ga0105237_10001452
154 Ga0105239_10001463
155 Ga0171462_1031
156 Ga0213875_10003322
157 Ga0209758_1000203
158 Ga0209050_1006535
159 Ga0209051_1004065
160 Ga0209257_1001660
161 Ga0207671_10001161
162 Ga0207664_10135745
163 Ga0209282_1034142
164 Ga0268266_10001484
165 Ga0265338_10005032
166 Ga0265325_10000502
167 Ga0265339_10000299
168 Ga0265331_10000134
169 Ga0307513_10153178
170 Ga0265313_10000316
171 Ga0265314_10000413
172 Ga0265342_10006618
173 Ga0316574_0204212
174 Ga0395905_0000221
175 Ga0436364_0864678
176 Ga0436364_0908968
177 Ga0436364_1375735
178 Ga0400484_08800
179 Ga0400489_25925
180 Ga0436360_0722169
181 Ga0495651_0214413
182 Ga0495607_0000096
183 Ga0495643_0004578
184 Ga0495648_0005780
185 Ga0495665_0036698
186 Ga0495661_0000916
187 Ga0495661_0014266
188 Ga0495589_0126475
189 Ga0496100_0005172
190 Ga0496100_0010933
191 Ga0496101_0063024
192 Ga0496102_0000575
193 Ga0496103_0000658
194 Ga0496105_0189228
195 Ga0496106_0043075
196 Ga0496108_0040982
197 Ga0496112_0021985
198 Ga0496113_0048426
199 Ga0496115_0325380
200 Ga0496116_0001143
201 Ga0496116_0002287
202 Ga0496117_0001127
203 Ga0496117_0002886
204 Ga0496118_0001757
205 Ga0496119_0002254
206 Ga0496119_0061098
207 Ga0496120_0001307
208 Ga0496120_0011060
209 Ga0496121_0000482
210 Ga0496121_0003096
211 Ga0496121_0010622
212 Ga0496122_0001837
213 Ga0496122_0032820
214 Ga0496123_0001463
215 Ga0496124_0000921
216 Ga0496124_0001680
217 Ga0496125_0023835
218 Ga0496126_0005605
219 Ga0496126_0011106
220 Ga0496126_0062572
221 Ga0501033_0009610
222 Ga0501033_0190956
223 Ga0501034_0001334
224 Ga0501034_0001398
225 Ga0501034_0004329
226 Ga0501034_0028448
227 Ga0501034_0031724
228 Ga0501034_0036320
229 Ga0501034_0040774
230 Ga0501034_0043416
231 Ga0501034_0053924
232 Ga0501034_0237653
233 Ga0501036_0249087
234 Ga0501038_0226761
235 Ga0501039_0296919
236 Ga0501039_0399757
237 Ga0501042_0199222
238 Ga0501046_0012599
239 Ga0501047_0025955
240 Ga0501047_0268252
241 Ga0501070_0002267
242 Ga0501070_0068360
243 Ga0501075_0091697
244 Ga0501075_0227392
245 Ga0501083_0075675
246 Ga0501044_0010847
247 Ga0501044_0213424
248 Ga0501045_0127586
249 nmdc:mga0sz30_109515_c1
250 Ga0495601_0243497
251 Ga0500618_000657
252 Ga0500616_0000351
253 Ga0500634_0003488
254 2585281509
255 2585993047
256 2586003781
257 2616312729
258 2643799729
259 2643913036
260 2644411510
261 2644474729
262 2644520115
263 2688393100
264 2838678948
265 2838717899
266 2838723245
267 2838728616
268 2841849821
269 2842128293
270 2842133901
271 2842155835
272 2842174145
273 2842179515
274 2842191036
275 2842215351
276 2842228010
277 2919118180
278 2926757944
279 2932405884
280 2933010860
281 2995396685
282 2996314736

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01180

DHO_dh

Dihydroorotate dehydrogenase

39

321

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ep3-assembly1.cif.gz_A crystal structure of lactococcus lactis dihydroorotate dehydrogenase b. data collected under cryogenic conditions. 0.9251 1 285
5ue9-assembly1.cif.gz_A wt dhodb with orotate bound 0.922 3 285
5ksw-assembly1.cif.gz_A dhodb-i74d mutant 0.9211 3 285
1ep2-assembly1.cif.gz_A-2 crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate 0.9045 1 285
1jqx-assembly1.cif.gz_B the r57a mutant of lactococcus lactis dihydroorotate dehydrogenase a 0.8766 4 290
ID Description Score Start End Superfamily
1ep1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9182 1 285 3.20.20.70
af_Q58070_5_305_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8749 4 289 3.20.20.70
1ep1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8689 1 285 3.20.20.70
af_P25889_6_307_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8674 4 276 3.20.20.70
af_Q4D3W2_1_314_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.847 1 292 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A432J1W7-F1-model_v4 Dihydroorotate dehydrogenase (DHOD) (DHODase) (DHOdehase) (EC 1.3.-.-) 0.959 1 287 GO:0004589
GO:0005737
GO:0006207
GO:0044205
AF-A0A4Q3J3Y7-F1-model_v4 dihydrouracil dehydrogenase (NAD(+)) (EC 1.3.1.1) 0.9517 76 292 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-Q64TN0-F1-model_v4 Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit (DHOD B) (DHODase B) (DHOdehase B) (EC 1.3.1.14) (Dihydroorotate oxidase B) (Orotate reductase (NADH)) 0.9492 1 290 GO:0004589
GO:0005737
GO:0006207
GO:0044205
AF-A6LB11-F1-model_v4 Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit (DHOD B) (DHODase B) (DHOdehase B) (EC 1.3.1.14) (Dihydroorotate oxidase B) (Orotate reductase (NADH)) 0.9492 1 290 GO:0004589
GO:0005737
GO:0006207
GO:0044205
AF-A0A496KIQ1-F1-model_v4 deleted 0.9489 1 288

Map