F183973
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 141 | 111 | 282 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300049744|Ga0501083_0202110|Ga0501083_0202110_251_1285 |
| Length | 344 |
| Sequence | VAAPSEDYINASSLPSGGEAFFISFRHRELPPVIGAAVDLEVQLGRLVLPNPILVASGTFGYAREMAGFVELKRLGGVVPKTITKLPRPGNPPWRTVETTGGMLNSIGLDNDGIDYFLANHLPYLGSLGTPIVVSVAGRTQEEFVELAGMLSGRSEVAAVELNISCPNVSGGVDFGTDPAMCERVVAGCRGSCDRPIIAKLTPNVSNIAAVAKGAEAGGADALSVINTCLGMAVDWRRRKPLLGNVLGGLSGPAIKPIALRCVYQTAKTVQIPIIGIGGIATLDDVMEFLVAGATAVQLGTVNFYDPTVSIRVLDGLPDALRQLGASRAADVVGTLVAAAPQGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 3 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 9 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 10 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 11 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 12 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 13 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 14 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 15 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 16 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 17 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 18 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 19 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 20 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 23 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 25 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 26 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 27 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 28 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 29 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 30 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 31 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 32 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 33 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 34 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 35 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 36 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 37 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 38 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 39 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 40 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 41 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 42 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 43 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 44 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 45 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 46 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 47 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 48 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 49 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 50 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 51 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 52 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 53 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 54 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 55 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 56 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 57 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 58 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 59 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 60 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 61 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 62 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 63 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 64 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 65 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 66 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 67 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 68 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 69 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 70 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 71 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 72 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 73 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 74 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 75 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 76 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 77 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 78 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 79 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 81 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 82 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 83 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 84 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 85 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 86 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 87 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 88 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 89 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 90 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 91 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 92 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 93 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 94 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 95 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 96 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 97 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 98 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 99 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 100 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 101 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 102 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 103 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 104 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 105 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 106 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 107 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 108 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 109 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 110 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 111 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.43 |
| Metatranscriptomes | 0 |
| Isolates | 20.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.51 |
| Nodule | 12.77 |
| Rhizoplane | 7.8 |
| Rhizosphere | 44.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501083_0202110 | 3300049744 | Bacteria | 1296 |
| 2 | Ga0055536_1009984 | 3300003781 | Bacteria | 3839 |
| 3 | Ga0055540_1014917 | 3300003792 | Bacteria | 2289 |
| 4 | Ga0055531_10000603 | 3300003794 | Bacteria | 31229 |
| 5 | Ga0065712_10083339 | 3300005290 | Bacteria | 2845 |
| 6 | Ga0070713_100351756 | 3300005436 | Bacteria | 1367 |
| 7 | Ga0070665_100000297 | 3300005548 | Bacteria | 77862 |
| 8 | Ga0068864_100358634 | 3300005618 | Bacteria | 1377 |
| 9 | Ga0075369_10071511 | 3300006186 | Bacteria | 1527 |
| 10 | Ga0075428_100016695 | 3300006844 | Bacteria | 8106 |
| 11 | Ga0099826_10007624 | 3300006948 | Bacteria | 7996 |
| 12 | Ga0105237_10001452 | 3300009545 | Bacteria | 31274 |
| 13 | Ga0105239_10001463 | 3300010375 | Bacteria | 31403 |
| 14 | Ga0171462_1031 | 3300013250 | Bacteria | 104981 |
| 15 | Ga0213875_10003322 | 3300021388 | Bacteria | 9193 |
| 16 | Ga0209758_1000203 | 3300025297 | Bacteria | 132184 |
| 17 | Ga0209050_1006535 | 3300025298 | Bacteria | 6869 |
| 18 | Ga0209051_1004065 | 3300025303 | Bacteria | 9219 |
| 19 | Ga0209257_1001660 | 3300025304 | Bacteria | 25215 |
| 20 | Ga0207671_10001161 | 3300025914 | Bacteria | 31406 |
| 21 | Ga0207664_10135745 | 3300025929 | Bacteria | 2076 |
| 22 | Ga0209282_1034142 | 3300027666 | Bacteria | 3093 |
| 23 | Ga0268266_10001484 | 3300028379 | Bacteria | 27833 |
| 24 | Ga0265338_10005032 | 3300028800 | Bacteria | 17461 |
| 25 | Ga0265325_10000502 | 3300031241 | Bacteria | 28249 |
| 26 | Ga0265339_10000299 | 3300031249 | Bacteria | 40398 |
| 27 | Ga0265331_10000134 | 3300031250 | Bacteria | 96927 |
| 28 | Ga0307513_10153178 | 3300031456 | Bacteria | 2210 |
| 29 | Ga0265313_10000316 | 3300031595 | Bacteria | 52476 |
| 30 | Ga0265314_10000413 | 3300031711 | Bacteria | 57497 |
| 31 | Ga0265342_10006618 | 3300031712 | Bacteria | 8603 |
| 32 | Ga0316574_0204212 | 3300035398 | Unclassified | 1269 |
| 33 | Ga0395905_0000221 | 3300037471 | Bacteria | 87203 |
| 34 | Ga0436364_0864678 | 3300037853 | Bacteria | 19504 |
| 35 | Ga0436364_0908968 | 3300037853 | Bacteria | 1275 |
| 36 | Ga0436364_1375735 | 3300037853 | Bacteria | 1161 |
| 37 | Ga0400484_08800 | 3300038725 | Bacteria | 3513 |
| 38 | Ga0400489_25925 | 3300039093 | Unclassified | 1551 |
| 39 | Ga0436360_0722169 | 3300039438 | Bacteria | 1530 |
| 40 | Ga0495651_0214413 | 3300046462 | Bacteria | 1337 |
| 41 | Ga0495607_0000096 | 3300046501 | Bacteria | 92031 |
| 42 | Ga0495643_0004578 | 3300046522 | Bacteria | 9628 |
| 43 | Ga0495648_0005780 | 3300046524 | Bacteria | 10203 |
| 44 | Ga0495665_0036698 | 3300046531 | Bacteria | 2616 |
| 45 | Ga0495661_0000916 | 3300046665 | Bacteria | 27044 |
| 46 | Ga0495661_0014266 | 3300046665 | Bacteria | 5325 |
| 47 | Ga0495589_0126475 | 3300046794 | Bacteria | 1229 |
| 48 | Ga0496100_0005172 | 3300048903 | Bacteria | 6997 |
| 49 | Ga0496100_0010933 | 3300048903 | Bacteria | 5150 |
| 50 | Ga0496101_0063024 | 3300048904 | Bacteria | 2697 |
| 51 | Ga0496102_0000575 | 3300048905 | Bacteria | 39009 |
| 52 | Ga0496103_0000658 | 3300048906 | Bacteria | 26129 |
| 53 | Ga0496105_0189228 | 3300048908 | Bacteria | 1683 |
| 54 | Ga0496106_0043075 | 3300048909 | Bacteria | 3386 |
| 55 | Ga0496108_0040982 | 3300048911 | Bacteria | 3863 |
| 56 | Ga0496112_0021985 | 3300048915 | Bacteria | 6071 |
| 57 | Ga0496113_0048426 | 3300048916 | Bacteria | 3162 |
| 58 | Ga0496115_0325380 | 3300048918 | Bacteria | 1257 |
| 59 | Ga0496116_0001143 | 3300048919 | Bacteria | 31538 |
| 60 | Ga0496116_0002287 | 3300048919 | Bacteria | 20319 |
| 61 | Ga0496117_0001127 | 3300048920 | Bacteria | 40289 |
| 62 | Ga0496117_0002886 | 3300048920 | Bacteria | 20840 |
| 63 | Ga0496118_0001757 | 3300048921 | Bacteria | 31406 |
| 64 | Ga0496119_0002254 | 3300048922 | Bacteria | 21451 |
| 65 | Ga0496119_0061098 | 3300048922 | Bacteria | 2253 |
| 66 | Ga0496120_0001307 | 3300048923 | Bacteria | 30979 |
| 67 | Ga0496120_0011060 | 3300048923 | Bacteria | 6229 |
| 68 | Ga0496121_0000482 | 3300048924 | Bacteria | 77205 |
| 69 | Ga0496121_0003096 | 3300048924 | Bacteria | 24045 |
| 70 | Ga0496121_0010622 | 3300048924 | Bacteria | 10343 |
| 71 | Ga0496122_0001837 | 3300048925 | Bacteria | 32363 |
| 72 | Ga0496122_0032820 | 3300048925 | Bacteria | 4284 |
| 73 | Ga0496123_0001463 | 3300048926 | Bacteria | 32772 |
| 74 | Ga0496124_0000921 | 3300048927 | Bacteria | 47487 |
| 75 | Ga0496124_0001680 | 3300048927 | Bacteria | 31404 |
| 76 | Ga0496125_0023835 | 3300048928 | Bacteria | 5641 |
| 77 | Ga0496126_0005605 | 3300048929 | Bacteria | 14275 |
| 78 | Ga0496126_0011106 | 3300048929 | Bacteria | 9356 |
| 79 | Ga0496126_0062572 | 3300048929 | Bacteria | 3339 |
| 80 | Ga0501033_0009610 | 3300049570 | Bacteria | 7442 |
| 81 | Ga0501033_0190956 | 3300049570 | Bacteria | 1466 |
| 82 | Ga0501034_0001334 | 3300049571 | Bacteria | 33320 |
| 83 | Ga0501034_0001398 | 3300049571 | Bacteria | 32452 |
| 84 | Ga0501034_0004329 | 3300049571 | Bacteria | 15833 |
| 85 | Ga0501034_0028448 | 3300049571 | Bacteria | 5688 |
| 86 | Ga0501034_0031724 | 3300049571 | Bacteria | 5367 |
| 87 | Ga0501034_0036320 | 3300049571 | Bacteria | 4992 |
| 88 | Ga0501034_0040774 | 3300049571 | Bacteria | 4698 |
| 89 | Ga0501034_0043416 | 3300049571 | Unclassified | 4550 |
| 90 | Ga0501034_0053924 | 3300049571 | Bacteria | 4048 |
| 91 | Ga0501034_0237653 | 3300049571 | Bacteria | 1769 |
| 92 | Ga0501036_0249087 | 3300049572 | Bacteria | 1489 |
| 93 | Ga0501038_0226761 | 3300049574 | Bacteria | 1489 |
| 94 | Ga0501039_0296919 | 3300049575 | Bacteria | 1270 |
| 95 | Ga0501039_0399757 | 3300049575 | Bacteria | 1079 |
| 96 | Ga0501042_0199222 | 3300049578 | Bacteria | 1444 |
| 97 | Ga0501046_0012599 | 3300049580 | Bacteria | 7190 |
| 98 | Ga0501047_0025955 | 3300049581 | Bacteria | 5634 |
| 99 | Ga0501047_0268252 | 3300049581 | Bacteria | 1553 |
| 100 | Ga0501070_0002267 | 3300049586 | Bacteria | 16908 |
| 101 | Ga0501070_0068360 | 3300049586 | Bacteria | 2941 |
| 102 | Ga0501075_0091697 | 3300049591 | Bacteria | 2306 |
| 103 | Ga0501075_0227392 | 3300049591 | Bacteria | 1423 |
| 104 | Ga0501083_0075675 | 3300049744 | Bacteria | 2236 |
| 105 | Ga0501044_0010847 | 3300049823 | Bacteria | 9885 |
| 106 | Ga0501044_0213424 | 3300049823 | Bacteria | 1883 |
| 107 | Ga0501045_0127586 | 3300049824 | Bacteria | 1890 |
| 108 | nmdc:mga0sz30_109515_c1 | 3300050516 | Bacteria | 1210 |
| 109 | Ga0495601_0243497 | 3300053077 | Bacteria | 1174 |
| 110 | Ga0500618_000657 | 3300053125 | Bacteria | 20576 |
| 111 | Ga0500616_0000351 | 3300053153 | Bacteria | 65787 |
| 112 | Ga0500634_0003488 | 3300053161 | Bacteria | 7009 |
| 113 | 2585281509 | 2582581308 | Bacteria | 7413247 |
| 114 | 2585993047 | 2585427633 | Bacteria | 6413184 |
| 115 | 2586003781 | 2585427634 | Bacteria | 6455027 |
| 116 | 2616312729 | 2615840626 | Bacteria | 7921970 |
| 117 | 2643799729 | 2643221556 | Bacteria | 7251154 |
| 118 | 2643913036 | 2643221580 | Bacteria | 3816678 |
| 119 | 2644411510 | 2643221674 | Bacteria | 3919126 |
| 120 | 2644474729 | 2643221684 | Bacteria | 7145183 |
| 121 | 2644520115 | 2643221693 | Bacteria | 5513853 |
| 122 | 2688393100 | 2687453341 | Bacteria | 6534136 |
| 123 | 2838678948 | 2838675328 | Bacteria | 4909118 |
| 124 | 2838717899 | 2838714209 | Bacteria | 5525906 |
| 125 | 2838723245 | 2838719591 | Bacteria | 5523910 |
| 126 | 2838728616 | 2838724970 | Bacteria | 4908691 |
| 127 | 2841849821 | 2841846520 | Bacteria | 5345850 |
| 128 | 2842128293 | 2842124991 | Bacteria | 5346824 |
| 129 | 2842133901 | 2842130223 | Bacteria | 4909145 |
| 130 | 2842155835 | 2842152218 | Bacteria | 4908957 |
| 131 | 2842174145 | 2842170452 | Bacteria | 5525737 |
| 132 | 2842179515 | 2842175837 | Bacteria | 4908771 |
| 133 | 2842191036 | 2842187318 | Bacteria | 5524014 |
| 134 | 2842215351 | 2842211629 | Bacteria | 5523832 |
| 135 | 2842228010 | 2842224351 | Bacteria | 5524473 |
| 136 | 2919118180 | 2919114240 | Bacteria | 5700270 |
| 137 | 2926757944 | 2926754445 | Bacteria | 5964435 |
| 138 | 2932405884 | 2932401849 | Bacteria | 4262978 |
| 139 | 2933010860 | 2933006813 | Bacteria | 4912075 |
| 140 | 2995396685 | 2995392953 | Bacteria | 4539380 |
| 141 | 2996314736 | 2996310559 | Bacteria | 6357320 |
| 142 | Ga0501083_0202110 | |||
| 143 | Ga0055536_1009984 | |||
| 144 | Ga0055540_1014917 | |||
| 145 | Ga0055531_10000603 | |||
| 146 | Ga0065712_10083339 | |||
| 147 | Ga0070713_100351756 | |||
| 148 | Ga0070665_100000297 | |||
| 149 | Ga0068864_100358634 | |||
| 150 | Ga0075369_10071511 | |||
| 151 | Ga0075428_100016695 | |||
| 152 | Ga0099826_10007624 | |||
| 153 | Ga0105237_10001452 | |||
| 154 | Ga0105239_10001463 | |||
| 155 | Ga0171462_1031 | |||
| 156 | Ga0213875_10003322 | |||
| 157 | Ga0209758_1000203 | |||
| 158 | Ga0209050_1006535 | |||
| 159 | Ga0209051_1004065 | |||
| 160 | Ga0209257_1001660 | |||
| 161 | Ga0207671_10001161 | |||
| 162 | Ga0207664_10135745 | |||
| 163 | Ga0209282_1034142 | |||
| 164 | Ga0268266_10001484 | |||
| 165 | Ga0265338_10005032 | |||
| 166 | Ga0265325_10000502 | |||
| 167 | Ga0265339_10000299 | |||
| 168 | Ga0265331_10000134 | |||
| 169 | Ga0307513_10153178 | |||
| 170 | Ga0265313_10000316 | |||
| 171 | Ga0265314_10000413 | |||
| 172 | Ga0265342_10006618 | |||
| 173 | Ga0316574_0204212 | |||
| 174 | Ga0395905_0000221 | |||
| 175 | Ga0436364_0864678 | |||
| 176 | Ga0436364_0908968 | |||
| 177 | Ga0436364_1375735 | |||
| 178 | Ga0400484_08800 | |||
| 179 | Ga0400489_25925 | |||
| 180 | Ga0436360_0722169 | |||
| 181 | Ga0495651_0214413 | |||
| 182 | Ga0495607_0000096 | |||
| 183 | Ga0495643_0004578 | |||
| 184 | Ga0495648_0005780 | |||
| 185 | Ga0495665_0036698 | |||
| 186 | Ga0495661_0000916 | |||
| 187 | Ga0495661_0014266 | |||
| 188 | Ga0495589_0126475 | |||
| 189 | Ga0496100_0005172 | |||
| 190 | Ga0496100_0010933 | |||
| 191 | Ga0496101_0063024 | |||
| 192 | Ga0496102_0000575 | |||
| 193 | Ga0496103_0000658 | |||
| 194 | Ga0496105_0189228 | |||
| 195 | Ga0496106_0043075 | |||
| 196 | Ga0496108_0040982 | |||
| 197 | Ga0496112_0021985 | |||
| 198 | Ga0496113_0048426 | |||
| 199 | Ga0496115_0325380 | |||
| 200 | Ga0496116_0001143 | |||
| 201 | Ga0496116_0002287 | |||
| 202 | Ga0496117_0001127 | |||
| 203 | Ga0496117_0002886 | |||
| 204 | Ga0496118_0001757 | |||
| 205 | Ga0496119_0002254 | |||
| 206 | Ga0496119_0061098 | |||
| 207 | Ga0496120_0001307 | |||
| 208 | Ga0496120_0011060 | |||
| 209 | Ga0496121_0000482 | |||
| 210 | Ga0496121_0003096 | |||
| 211 | Ga0496121_0010622 | |||
| 212 | Ga0496122_0001837 | |||
| 213 | Ga0496122_0032820 | |||
| 214 | Ga0496123_0001463 | |||
| 215 | Ga0496124_0000921 | |||
| 216 | Ga0496124_0001680 | |||
| 217 | Ga0496125_0023835 | |||
| 218 | Ga0496126_0005605 | |||
| 219 | Ga0496126_0011106 | |||
| 220 | Ga0496126_0062572 | |||
| 221 | Ga0501033_0009610 | |||
| 222 | Ga0501033_0190956 | |||
| 223 | Ga0501034_0001334 | |||
| 224 | Ga0501034_0001398 | |||
| 225 | Ga0501034_0004329 | |||
| 226 | Ga0501034_0028448 | |||
| 227 | Ga0501034_0031724 | |||
| 228 | Ga0501034_0036320 | |||
| 229 | Ga0501034_0040774 | |||
| 230 | Ga0501034_0043416 | |||
| 231 | Ga0501034_0053924 | |||
| 232 | Ga0501034_0237653 | |||
| 233 | Ga0501036_0249087 | |||
| 234 | Ga0501038_0226761 | |||
| 235 | Ga0501039_0296919 | |||
| 236 | Ga0501039_0399757 | |||
| 237 | Ga0501042_0199222 | |||
| 238 | Ga0501046_0012599 | |||
| 239 | Ga0501047_0025955 | |||
| 240 | Ga0501047_0268252 | |||
| 241 | Ga0501070_0002267 | |||
| 242 | Ga0501070_0068360 | |||
| 243 | Ga0501075_0091697 | |||
| 244 | Ga0501075_0227392 | |||
| 245 | Ga0501083_0075675 | |||
| 246 | Ga0501044_0010847 | |||
| 247 | Ga0501044_0213424 | |||
| 248 | Ga0501045_0127586 | |||
| 249 | nmdc:mga0sz30_109515_c1 | |||
| 250 | Ga0495601_0243497 | |||
| 251 | Ga0500618_000657 | |||
| 252 | Ga0500616_0000351 | |||
| 253 | Ga0500634_0003488 | |||
| 254 | 2585281509 | |||
| 255 | 2585993047 | |||
| 256 | 2586003781 | |||
| 257 | 2616312729 | |||
| 258 | 2643799729 | |||
| 259 | 2643913036 | |||
| 260 | 2644411510 | |||
| 261 | 2644474729 | |||
| 262 | 2644520115 | |||
| 263 | 2688393100 | |||
| 264 | 2838678948 | |||
| 265 | 2838717899 | |||
| 266 | 2838723245 | |||
| 267 | 2838728616 | |||
| 268 | 2841849821 | |||
| 269 | 2842128293 | |||
| 270 | 2842133901 | |||
| 271 | 2842155835 | |||
| 272 | 2842174145 | |||
| 273 | 2842179515 | |||
| 274 | 2842191036 | |||
| 275 | 2842215351 | |||
| 276 | 2842228010 | |||
| 277 | 2919118180 | |||
| 278 | 2926757944 | |||
| 279 | 2932405884 | |||
| 280 | 2933010860 | |||
| 281 | 2995396685 | |||
| 282 | 2996314736 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ep3-assembly1.cif.gz_A | crystal structure of lactococcus lactis dihydroorotate dehydrogenase b. data collected under cryogenic conditions. | 0.9251 | 1 | 285 |
| 5ue9-assembly1.cif.gz_A | wt dhodb with orotate bound | 0.922 | 3 | 285 |
| 5ksw-assembly1.cif.gz_A | dhodb-i74d mutant | 0.9211 | 3 | 285 |
| 1ep2-assembly1.cif.gz_A-2 | crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate | 0.9045 | 1 | 285 |
| 1jqx-assembly1.cif.gz_B | the r57a mutant of lactococcus lactis dihydroorotate dehydrogenase a | 0.8766 | 4 | 290 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ep1A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9182 | 1 | 285 | 3.20.20.70 |
| af_Q58070_5_305_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8749 | 4 | 289 | 3.20.20.70 |
| 1ep1A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8689 | 1 | 285 | 3.20.20.70 |
| af_P25889_6_307_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8674 | 4 | 276 | 3.20.20.70 |
| af_Q4D3W2_1_314_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.847 | 1 | 292 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A432J1W7-F1-model_v4 | Dihydroorotate dehydrogenase (DHOD) (DHODase) (DHOdehase) (EC 1.3.-.-) | 0.959 | 1 | 287 |
GO:0004589
GO:0005737 GO:0006207 GO:0044205 |
| AF-A0A4Q3J3Y7-F1-model_v4 | dihydrouracil dehydrogenase (NAD(+)) (EC 1.3.1.1) | 0.9517 | 76 | 292 |
GO:0004152
GO:0005737 GO:0006207 GO:0044205 |
| AF-Q64TN0-F1-model_v4 | Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit (DHOD B) (DHODase B) (DHOdehase B) (EC 1.3.1.14) (Dihydroorotate oxidase B) (Orotate reductase (NADH)) | 0.9492 | 1 | 290 |
GO:0004589
GO:0005737 GO:0006207 GO:0044205 |
| AF-A6LB11-F1-model_v4 | Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit (DHOD B) (DHODase B) (DHOdehase B) (EC 1.3.1.14) (Dihydroorotate oxidase B) (Orotate reductase (NADH)) | 0.9492 | 1 | 290 |
GO:0004589
GO:0005737 GO:0006207 GO:0044205 |
| AF-A0A496KIQ1-F1-model_v4 | deleted | 0.9489 | 1 | 288 |
|