F183943

General Info

Members Datasets Scaffolds Average Seq Length
141 113 282 416

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0178764|Ga0501072_0178764_94_1518
Length 442
Sequence VSANIADQYESFGGGHGAVRRIRLLALTANLCPGSDVHEGEEIELSSKAWRVATGETITMWTRAATQTQSERLVKAYNDTHENQVELTVIPTDNYQARIAAAAGGKNLPDVFASDVIYAPNYTSQGLYLDITDRIDELDFADALAPAHMRLGTYEDAKYTVPHTLDLSVLFWNKDLYKKAGLDPEKPPTTMKEFAEQAKTVREKVGGKTYGTFFGGNCPGCFVFTFWPSVWAAGGDIMNEDGTESTIDDPNMQATFEIYNDLVKNDVVAPGNKTEAGPTWTGVFPKGNVGVMPMPSTTLGLMPEGMDIGVAPIPGPDGGESTFVGGDVLGIGATTDKEDAAWDFVSWTLSEDAQVEILAKNKDVVGRTDLADNKYSAEDPRVVTINELVAKGETPYSLNFGATYNDPTGPWLKVARDAVYGDDVAGALSSGKESITASLAQQ

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
36 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
37 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
40 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
41 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
42 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
47 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
48 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
49 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
50 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
51 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
52 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
53 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
59 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
60 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
61 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
62 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
63 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
64 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
65 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
66 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
67 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
68 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
69 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
73 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
74 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
75 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
76 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
78 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
79 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
80 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
81 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
82 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
83 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
84 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
85 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
86 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
87 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
88 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
89 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
90 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
91 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
92 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
93 2643221647 Streptomyces sp. Root369 Isolate Unclassified
94 2643221649 Leifsonia sp. Root4 Isolate Unclassified
95 2643221714 Streptomyces sp. Root264 Isolate Unclassified
96 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
97 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
98 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
99 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
100 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
101 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
102 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
103 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
104 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
105 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
106 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
107 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
108 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
109 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
110 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
111 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
112 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
113 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.11
Metatranscriptomes 0
Isolates 14.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.93
Nodule 2.13
Rhizoplane 2.84
Rhizosphere 68.09
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0178764 3300049588 Bacteria 1692
2 JGI25406J46586_10000266 3300003203 Bacteria 23238
3 JGI25407J50210_10017754 3300003373 Bacteria 1848
4 Ga0070683_100054313 3300005329 Bacteria 3714
5 Ga0070683_100084726 3300005329 Bacteria 2970
6 Ga0070683_100144106 3300005329 Bacteria 2257
7 Ga0068869_100063690 3300005334 Bacteria 2710
8 Ga0070673_100059712 3300005364 Bacteria 3020
9 Ga0070667_100065105 3300005367 Bacteria 3094
10 Ga0070701_10005321 3300005438 Bacteria 5303
11 Ga0070678_100031913 3300005456 Bacteria 3639
12 Ga0070679_100153429 3300005530 Unclassified 2279
13 Ga0070702_100017870 3300005615 Bacteria 3667
14 Ga0081455_10010066 3300005937 Bacteria 9652
15 Ga0081538_10000356 3300005981 Bacteria 52018
16 Ga0081538_10005622 3300005981 Bacteria 11247
17 Ga0081538_10030672 3300005981 Bacteria 3644
18 Ga0081538_10057563 3300005981 Bacteria 2263
19 Ga0081540_1051248 3300005983 Bacteria 2043
20 Ga0081539_10000304 3300005985 Bacteria 110884
21 Ga0075363_100032931 3300006048 Bacteria 2695
22 Ga0068871_100016017 3300006358 Bacteria 5633
23 Ga0075428_100018925 3300006844 Bacteria 7616
24 Ga0075431_100026286 3300006847 Bacteria 5971
25 Ga0099826_10092340 3300006948 Bacteria 1848
26 Ga0111539_10021045 3300009094 Bacteria 8033
27 Ga0105245_10077761 3300009098 Bacteria 3026
28 Ga0114129_10000415 3300009147 Bacteria 50453
29 Ga0114129_10114813 3300009147 Bacteria 3713
30 Ga0105239_10090097 3300010375 Bacteria 3384
31 Ga0105246_10062894 3300011119 Bacteria 2587
32 Ga0163163_10115854 3300014325 Bacteria 2711
33 Ga0207652_10053715 3300025921 Bacteria 3461
34 Ga0207652_10260426 3300025921 Bacteria 1564
35 Ga0207689_10031568 3300025942 Bacteria 4409
36 Ga0207661_10015002 3300025944 Bacteria 5690
37 Ga0207708_10170284 3300026075 Bacteria 1724
38 Ga0207702_10313790 3300026078 Bacteria 1491
39 Ga0207683_10040705 3300026121 Bacteria 4057
40 Ga0207428_10090352 3300027907 Bacteria 2379
41 Ga0307515_10019192 3300028794 Bacteria 12325
42 Ga0307515_10053111 3300028794 Bacteria 5988
43 Ga0307515_10229345 3300028794 Unclassified 1654
44 Ga0307511_10141923 3300030521 Bacteria 1408
45 Ga0307512_10020062 3300030522 Bacteria 6064
46 Ga0307509_10000177 3300031507 Bacteria 100248
47 Ga0307509_10032325 3300031507 Bacteria 5766
48 Ga0307408_100244333 3300031548 Bacteria 1477
49 Ga0307508_10002105 3300031616 Bacteria 21365
50 Ga0307508_10029325 3300031616 Bacteria 4975
51 Ga0307508_10177836 3300031616 Bacteria 1731
52 Ga0307514_10011494 3300031649 Bacteria 7357
53 Ga0307516_10035318 3300031730 Bacteria 5017
54 Ga0307516_10149707 3300031730 Bacteria 2096
55 Ga0307406_10008513 3300031901 Bacteria 5728
56 Ga0307406_10116443 3300031901 Bacteria 1849
57 Ga0307409_100002310 3300031995 Bacteria 9893
58 Ga0307409_100033833 3300031995 Bacteria 3725
59 Ga0307409_100108719 3300031995 Bacteria 2320
60 Ga0307416_100000421 3300032002 Bacteria 21577
61 Ga0307416_100017852 3300032002 Bacteria 4979
62 Ga0307416_100216686 3300032002 Bacteria 1832
63 Ga0307415_100000042 3300032126 Bacteria 54702
64 Ga0307415_100087698 3300032126 Bacteria 2243
65 Ga0307415_100226530 3300032126 Bacteria 1502
66 Ga0373938_0011464 3300034957 Bacteria 1649
67 Ga0373949_0000018 3300035090 Bacteria 59252
68 Ga0373941_0012675 3300035115 Bacteria 2210
69 Ga0373942_0000321 3300035207 Bacteria 13049
70 Ga0373962_0001048 3300035242 Bacteria 6423
71 Ga0451853_0871288 3300041512 Bacteria 2461
72 Ga0451853_1074868 3300041512 Bacteria 2779
73 Ga0439449_0017018 3300042007 Bacteria 2729
74 Ga0466969_0006663 3300044656 Bacteria 6137
75 Ga0466966_0015341 3300044684 Bacteria 5066
76 Ga0466963_0035939 3300044694 Bacteria 3229
77 Ga0466957_0030179 3300044842 Bacteria 3237
78 Ga0466967_0000131 3300045976 Bacteria 28609
79 Ga0466967_0167011 3300045976 Bacteria 2068
80 Ga0495594_0047553 3300046499 Bacteria 2356
81 Ga0495668_0000471 3300046616 Bacteria 50892
82 Ga0495625_0000265 3300046660 Bacteria 81480
83 Ga0495599_0122275 3300046678 Bacteria 1618
84 Ga0495674_0021487 3300047319 Bacteria 5969
85 Ga0495676_0261257 3300047321 Bacteria 1178
86 Ga0495683_0019284 3300047323 Bacteria 3521
87 Ga0495626_0000509 3300048091 Bacteria 38930
88 Ga0496108_0129397 3300048911 Bacteria 2170
89 Ga0496109_0018759 3300048912 Bacteria 6083
90 Ga0496110_0055849 3300048913 Bacteria 3475
91 Ga0496112_0169200 3300048915 Bacteria 2151
92 Ga0501036_0116711 3300049572 Bacteria 2254
93 Ga0501047_0307774 3300049581 Unclassified 1426
94 Ga0501068_0070398 3300049584 Bacteria 2134
95 Ga0501072_0233409 3300049588 Bacteria 1465
96 Ga0501075_0141669 3300049591 Bacteria 1832
97 Ga0501076_0103351 3300049592 Bacteria 2298
98 Ga0501077_0063041 3300049593 Bacteria 2352
99 Ga0501044_0003911 3300049823 Bacteria 16699
100 Ga0501045_0039269 3300049824 Bacteria 3444
101 nmdc:mga05p37_5404_c1 3300050507 Bacteria 15019
102 nmdc:mga06r32_210674_c1 3300050510 Bacteria 1931
103 nmdc:mga06r32_38815_c1 3300050510 Bacteria 4515
104 nmdc:mga08y16_20148_c1 3300050511 Bacteria 7039
105 Ga0495601_0058226 3300053077 Bacteria 2448
106 Ga0495619_0009319 3300053085 Bacteria 6197
107 Ga0500646_0000371 3300053090 Bacteria 13577
108 Ga0500566_0003950 3300053094 Bacteria 8846
109 Ga0500566_0006413 3300053094 Bacteria 6983
110 Ga0500566_0090078 3300053094 Unclassified 1696
111 Ga0500640_000855 3300053095 Bacteria 8420
112 Ga0500554_000812 3300053102 Bacteria 6157
113 Ga0500554_037670 3300053102 Unclassified 1468
114 Ga0500595_000155 3300053119 Bacteria 45063
115 Ga0500597_001841 3300053120 Bacteria 5617
116 Ga0500614_000034 3300053123 Bacteria 30355
117 Ga0500614_001299 3300053123 Bacteria 6034
118 Ga0500559_0002797 3300053136 Bacteria 8824
119 Ga0500588_0013005 3300053146 Bacteria 2079
120 Ga0466962_0071436 3300061719 Bacteria 1658
121 2644263885 2643221647 Bacteria 10741251
122 2644277918 2643221649 Bacteria 3867359
123 2644627214 2643221714 Bacteria 9015452
124 2676495837 2675903060 Bacteria 10051191
125 2785373199 2784746768 Bacteria 10036182
126 2808846150 2808606359 Bacteria 9866990
127 2862393032 2862382967 Bacteria 10317375
128 2862993971 2862993130 Bacteria 3860849
129 2870722792 2870721527 Bacteria 9689237
130 2884703511 2884693830 Bacteria 11273186
131 2895432154 2895427314 Bacteria 13147766
132 2895443462 2895442618 Bacteria 11027144
133 2946079736 2946072368 Bacteria 8999607
134 2947233002 2947224130 Bacteria 9938529
135 2954382475 2954380949 Bacteria 10050426
136 2954693276 2954691527 Bacteria 10720516
137 2954708370 2954701450 Bacteria 10834262
138 3006497570 3006493962 Bacteria 8825450
139 8001782825 8001781756 Bacteria 9586736
140 8008560915 8008558824 Bacteria 10610750
141 8055070344 8055066027 Bacteria 9479577
142 Ga0501072_0178764
143 JGI25406J46586_10000266
144 JGI25407J50210_10017754
145 Ga0070683_100054313
146 Ga0070683_100084726
147 Ga0070683_100144106
148 Ga0068869_100063690
149 Ga0070673_100059712
150 Ga0070667_100065105
151 Ga0070701_10005321
152 Ga0070678_100031913
153 Ga0070679_100153429
154 Ga0070702_100017870
155 Ga0081455_10010066
156 Ga0081538_10000356
157 Ga0081538_10005622
158 Ga0081538_10030672
159 Ga0081538_10057563
160 Ga0081540_1051248
161 Ga0081539_10000304
162 Ga0075363_100032931
163 Ga0068871_100016017
164 Ga0075428_100018925
165 Ga0075431_100026286
166 Ga0099826_10092340
167 Ga0111539_10021045
168 Ga0105245_10077761
169 Ga0114129_10000415
170 Ga0114129_10114813
171 Ga0105239_10090097
172 Ga0105246_10062894
173 Ga0163163_10115854
174 Ga0207652_10053715
175 Ga0207652_10260426
176 Ga0207689_10031568
177 Ga0207661_10015002
178 Ga0207708_10170284
179 Ga0207702_10313790
180 Ga0207683_10040705
181 Ga0207428_10090352
182 Ga0307515_10019192
183 Ga0307515_10053111
184 Ga0307515_10229345
185 Ga0307511_10141923
186 Ga0307512_10020062
187 Ga0307509_10000177
188 Ga0307509_10032325
189 Ga0307408_100244333
190 Ga0307508_10002105
191 Ga0307508_10029325
192 Ga0307508_10177836
193 Ga0307514_10011494
194 Ga0307516_10035318
195 Ga0307516_10149707
196 Ga0307406_10008513
197 Ga0307406_10116443
198 Ga0307409_100002310
199 Ga0307409_100033833
200 Ga0307409_100108719
201 Ga0307416_100000421
202 Ga0307416_100017852
203 Ga0307416_100216686
204 Ga0307415_100000042
205 Ga0307415_100087698
206 Ga0307415_100226530
207 Ga0373938_0011464
208 Ga0373949_0000018
209 Ga0373941_0012675
210 Ga0373942_0000321
211 Ga0373962_0001048
212 Ga0451853_0871288
213 Ga0451853_1074868
214 Ga0439449_0017018
215 Ga0466969_0006663
216 Ga0466966_0015341
217 Ga0466963_0035939
218 Ga0466957_0030179
219 Ga0466967_0000131
220 Ga0466967_0167011
221 Ga0495594_0047553
222 Ga0495668_0000471
223 Ga0495625_0000265
224 Ga0495599_0122275
225 Ga0495674_0021487
226 Ga0495676_0261257
227 Ga0495683_0019284
228 Ga0495626_0000509
229 Ga0496108_0129397
230 Ga0496109_0018759
231 Ga0496110_0055849
232 Ga0496112_0169200
233 Ga0501036_0116711
234 Ga0501047_0307774
235 Ga0501068_0070398
236 Ga0501072_0233409
237 Ga0501075_0141669
238 Ga0501076_0103351
239 Ga0501077_0063041
240 Ga0501044_0003911
241 Ga0501045_0039269
242 nmdc:mga05p37_5404_c1
243 nmdc:mga06r32_210674_c1
244 nmdc:mga06r32_38815_c1
245 nmdc:mga08y16_20148_c1
246 Ga0495601_0058226
247 Ga0495619_0009319
248 Ga0500646_0000371
249 Ga0500566_0003950
250 Ga0500566_0006413
251 Ga0500566_0090078
252 Ga0500640_000855
253 Ga0500554_000812
254 Ga0500554_037670
255 Ga0500595_000155
256 Ga0500597_001841
257 Ga0500614_000034
258 Ga0500614_001299
259 Ga0500559_0002797
260 Ga0500588_0013005
261 Ga0466962_0071436
262 2644263885
263 2644277918
264 2644627214
265 2676495837
266 2785373199
267 2808846150
268 2862393032
269 2862993971
270 2870722792
271 2884703511
272 2895432154
273 2895443462
274 2946079736
275 2947233002
276 2954382475
277 2954693276
278 2954708370
279 3006497570
280 8001782825
281 8008560915
282 8055070344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

72

384

0.88

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

64

355

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lce-assembly1.cif.gz_A crystal structure of beta-l-arabinobiose binding protein - selenomethionine derivative 0.9167 26 412
6lce-assembly1.cif.gz_A crystal structure of beta-l-arabinobiose binding protein - selenomethionine derivative 0.8716 26 412
7c6z-assembly1.cif.gz_A crystal structure of beta-glycosides-binding protein (w67a) of abc transporter in an open state 0.868 32 412
3uor-assembly2.cif.gz_B the structure of the sugar-binding protein male from the phytopathogen xanthomonas citri 0.8634 32 414
7c6x-assembly7.cif.gz_G crystal structure of beta-glycosides-binding protein (w41a) of abc transporter in an open state (form i) 0.8621 33 412
ID Description Score Start End Superfamily
5ysdB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8343 32 369 3.40.190.10
4mfiA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8314 28 414 3.40.190.10
4g68C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8309 32 135 3.40.190.10
2ghaA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.83 30 139 3.40.190.10
5ci5B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.823 32 355 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4Q3XQK1-F1-model_v4 deleted 0.9508 134 412
AF-A0A526YUU4-F1-model_v4 Extracellular solute-binding protein 0.9435 30 413 GO:0015768
GO:0042597
GO:0042956
GO:0055052
GO:1901982
AF-A0A4Q3XQK1-F1-model_v4 deleted 0.941 134 412
AF-A0A3S2BP03-F1-model_v4 deleted 0.9402 185 414
AF-A0A434ESW6-F1-model_v4 Extracellular solute-binding protein 0.9207 150 356 GO:0015768
GO:0042597
GO:0042956
GO:0055052
GO:1901982

Map