F183606

General Info

Members Datasets Scaffolds Average Seq Length
141 102 282 152

Family's Representative Sequence

Representative Sequence 3300046477|Ga0495664_0241622|Ga0495664_0241622_212_793
Length 193
Sequence MRLETLLPGPMLMRIQGGSSAPEVAENMSLRLVPMTLAQANEHVAAWHRHNRPVPGAKFSIGAADDDGILHAVAICGRPVARAFDDGDTIEVCRVASDGTRNACSMLYGACSRAAFALGYRRVITYTQIDESGSSLRGAGWKVIAKRPTRVGWSVPSRPRDNGKYVPSNRQLWESVGGVIAQAHLAGTPSEDT

Samples

Sample ID Description Type Environment
1 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
15 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
21 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
26 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
40 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
46 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
47 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
48 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
49 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
50 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
51 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
52 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
53 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
63 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
64 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
65 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
66 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
67 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
68 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
69 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
70 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
74 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
82 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
87 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
96 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
97 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
98 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
99 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
100 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
101 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
102 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.67
Nodule 2.84
Rhizoplane 2.84
Rhizosphere 87.94
Stem 0
Stem Tuber 0
Unclassified 26.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495664_0241622 3300046477 Unclassified 1092
2 SwRhRL2b_contig_929807 2162886007 Viruses 2552
3 JGI24739J22299_10022866 3300001989 Bacteria 2214
4 JGI25151J46595_10002683 3300003187 Bacteria 10412
5 JGI25160J50197_1001564 3300003354 Bacteria 11283
6 Ga0065704_10089985 3300005289 Viruses 2819
7 Ga0070674_100338653 3300005356 Bacteria 1211
8 Ga0070674_100781903 3300005356 Bacteria 823
9 Ga0070679_100081337 3300005530 Bacteria 3228
10 Ga0070679_100251460 3300005530 Unclassified 1723
11 Ga0070686_100056132 3300005544 Bacteria 2525
12 Ga0070665_100096451 3300005548 Bacteria 2962
13 Ga0068855_100265333 3300005563 Unclassified 1911
14 Ga0068859_100488707 3300005617 Unclassified 1326
15 Ga0097620_100488686 3300006931 Unclassified 1326
16 Ga0079104_1000571 3300006946 Bacteria 37351
17 Ga0105242_10001952 3300009176 Bacteria 16227
18 Ga0105248_10000766 3300009177 Bacteria 36050
19 Ga0105248_10349334 3300009177 Bacteria 1665
20 Ga0105248_11026839 3300009177 Unclassified 932
21 Ga0105238_10011335 3300009551 Bacteria 8970
22 Ga0105238_10166272 3300009551 Unclassified 2182
23 Ga0105249_10721217 3300009553 Bacteria 1058
24 Ga0157374_10024895 3300013296 Bacteria 5369
25 Ga0157380_12779819 3300014326 Unclassified 556
26 Ga0157379_10351722 3300014968 Bacteria 1349
27 Ga0157376_10133909 3300014969 Unclassified 2215
28 Ga0183362_10001 3300015683 Bacteria 2046624
29 Ga0163161_10009125 3300017792 Bacteria 6855
30 Ga0209129_1000271 3300025258 Bacteria 50447
31 Ga0209025_1000675 3300025294 Bacteria 58767
32 Ga0209758_1001427 3300025297 Bacteria 28257
33 Ga0207426_1000627 3300025302 Bacteria 44831
34 Ga0207707_10041399 3300025912 Bacteria 4024
35 Ga0207707_10331314 3300025912 Unclassified 1313
36 Ga0207652_10753631 3300025921 Unclassified 866
37 Ga0207694_10041745 3300025924 Bacteria 3536
38 Ga0207694_10292211 3300025924 Viruses 1340
39 Ga0207686_10001014 3300025934 Bacteria 16636
40 Ga0207669_10725965 3300025937 Bacteria 818
41 Ga0207711_10000458 3300025941 Bacteria 42641
42 Ga0207667_10092688 3300025949 Viruses 3120
43 Ga0207667_10378362 3300025949 Bacteria 1443
44 Ga0207702_10001172 3300026078 Bacteria 26762
45 Ga0207648_10119603 3300026089 Bacteria 2315
46 Ga0207676_10117036 3300026095 Viruses 2241
47 Ga0209281_1000518 3300027111 Bacteria 50204
48 Ga0209588_1243533 3300027671 Unclassified 551
49 Ga0268266_10072236 3300028379 Bacteria 2992
50 Ga0265336_10020507 3300028666 Bacteria 2120
51 Ga0265338_10052298 3300028800 Bacteria 3667
52 Ga0316579_10000011 3300031691 Bacteria 45186
53 Ga0307516_10000762 3300031730 Bacteria 43898
54 Ga0373934_0005851 3300035086 Unclassified 4550
55 Ga0373953_0019888 3300035117 Bacteria 2503
56 Ga0373953_0031644 3300035117 Unclassified 2058
57 Ga0373954_0008147 3300035118 Viruses 4592
58 Ga0373954_0051404 3300035118 Unclassified 1935
59 Ga0373954_0377471 3300035118 Unclassified 700
60 Ga0373956_0008994 3300035119 Bacteria 4049
61 Ga0373956_0214883 3300035119 Bacteria 912
62 Ga0373957_0034314 3300035120 Unclassified 1878
63 Ga0373957_0071747 3300035120 Unclassified 1355
64 Ga0373955_0179704 3300035172 Bacteria 1255
65 Ga0373924_0007331 3300035410 Viruses 3979
66 Ga0373924_0027887 3300035410 Unclassified 2247
67 Ga0373933_0030905 3300035724 Bacteria 3103
68 Ga0373937_0179916 3300036401 Unclassified 1985
69 Ga0373937_0720709 3300036401 Bacteria 944
70 Ga0395899_0029012 3300037312 Bacteria 4162
71 Ga0395899_0045782 3300037312 Viruses 3259
72 Ga0395899_0115455 3300037312 Bacteria 1927
73 Ga0395900_0033560 3300037418 Bacteria 5281
74 Ga0395900_0776042 3300037418 Bacteria 887
75 Ga0395898_0012719 3300037466 Bacteria 8692
76 Ga0395898_0021191 3300037466 Bacteria 6593
77 Ga0395898_0048416 3300037466 Bacteria 4169
78 Ga0395898_0793328 3300037466 Bacteria 887
79 Ga0395905_0064030 3300037471 Bacteria 3440
80 Ga0395901_0051589 3300038443 Bacteria 4277
81 Ga0395901_0419592 3300038443 Bacteria 1372
82 Ga0395901_0866078 3300038443 Bacteria 887
83 Ga0395901_1278555 3300038443 Bacteria 696
84 Ga0466958_0410538 3300045836 Bacteria 875
85 Ga0466967_2012262 3300045976 Bacteria 574
86 Ga0495592_0011861 3300046454 Bacteria 6603
87 Ga0495592_0048265 3300046454 Viruses 3167
88 Ga0495592_0358985 3300046454 Bacteria 932
89 Ga0495651_0449321 3300046462 Unclassified 833
90 Ga0495653_0005006 3300046463 Bacteria 10753
91 Ga0495653_0055991 3300046463 Bacteria 3008
92 Ga0495664_0077061 3300046477 Unclassified 1996
93 Ga0495664_0120767 3300046477 Bacteria 1585
94 Ga0495608_0180967 3300046511 Unclassified 1333
95 Ga0495618_0000101 3300046514 Bacteria 62766
96 Ga0495628_0037132 3300046516 Bacteria 3907
97 Ga0495630_0533865 3300046517 Bacteria 900
98 Ga0495630_0543811 3300046517 Unclassified 891
99 Ga0495632_0039140 3300046519 Unclassified 2396
100 Ga0495643_0004999 3300046522 Bacteria 9090
101 Ga0495652_0013706 3300046529 Bacteria 7294
102 Ga0495640_0010888 3300046533 Bacteria 7011
103 Ga0495640_0092659 3300046533 Unclassified 1992
104 Ga0495586_0047694 3300046535 Bacteria 2313
105 Ga0495586_0469032 3300046535 Unclassified 726
106 Ga0495609_0081226 3300046538 Bacteria 1417
107 Ga0495645_0031567 3300046543 Viruses 3860
108 Ga0495645_0604103 3300046543 Unclassified 674
109 Ga0495667_0040007 3300046559 Bacteria 3114
110 Ga0495634_0073711 3300046642 Unclassified 2244
111 Ga0495634_0236132 3300046642 Bacteria 1123
112 Ga0495625_0005700 3300046660 Bacteria 11277
113 Ga0495635_0004232 3300046663 Bacteria 9953
114 Ga0495635_0014100 3300046663 Bacteria 5593
115 Ga0495599_0140238 3300046678 Bacteria 1500
116 Ga0495623_0041675 3300046679 Bacteria 2927
117 Ga0495646_0012039 3300046680 Bacteria 5504
118 Ga0495613_0003627 3300046689 Bacteria 11563
119 Ga0495604_0155201 3300047317 Unclassified 1622
120 Ga0495674_0034469 3300047319 Unclassified 4578
121 Ga0495674_0072940 3300047319 Viruses 2960
122 Ga0495674_0852468 3300047319 Unclassified 706
123 Ga0495675_0006756 3300047444 Bacteria 7035
124 Ga0495675_0013293 3300047444 Viruses 5194
125 Ga0495675_0222547 3300047444 Unclassified 1141
126 Ga0495681_0141336 3300047470 Unclassified 1017
127 Ga0495684_0020870 3300047471 Bacteria 5047
128 Ga0495602_0076230 3300048088 Bacteria 2842
129 Ga0496104_0210663 3300048907 Viruses 1855
130 Ga0496113_0454686 3300048916 Viruses 1029
131 Ga0496114_0127163 3300048917 Unclassified 2198
132 Ga0496115_1073268 3300048918 Bacteria 612
133 Ga0501043_0035730 3300049579 Viruses 3909
134 Ga0501227_000320 3300049665 Bacteria 10054
135 nmdc:mga08y16_485832_c1 3300050511 Bacteria 1256
136 Ga0495601_0202049 3300053077 Unclassified 1298
137 Ga0495619_0133373 3300053085 Unclassified 1707
138 Ga0500616_0092211 3300053153 Bacteria 1498
139 Ga0500636_0002488 3300053177 Bacteria 10228
140 2513575473 2513237085 Bacteria 7695351
141 2517094666 2517093000 Bacteria 7412387
142 Ga0495664_0241622
143 SwRhRL2b_contig_929807
144 JGI24739J22299_10022866
145 JGI25151J46595_10002683
146 JGI25160J50197_1001564
147 Ga0065704_10089985
148 Ga0070674_100338653
149 Ga0070674_100781903
150 Ga0070679_100081337
151 Ga0070679_100251460
152 Ga0070686_100056132
153 Ga0070665_100096451
154 Ga0068855_100265333
155 Ga0068859_100488707
156 Ga0097620_100488686
157 Ga0079104_1000571
158 Ga0105242_10001952
159 Ga0105248_10000766
160 Ga0105248_10349334
161 Ga0105248_11026839
162 Ga0105238_10011335
163 Ga0105238_10166272
164 Ga0105249_10721217
165 Ga0157374_10024895
166 Ga0157380_12779819
167 Ga0157379_10351722
168 Ga0157376_10133909
169 Ga0183362_10001
170 Ga0163161_10009125
171 Ga0209129_1000271
172 Ga0209025_1000675
173 Ga0209758_1001427
174 Ga0207426_1000627
175 Ga0207707_10041399
176 Ga0207707_10331314
177 Ga0207652_10753631
178 Ga0207694_10041745
179 Ga0207694_10292211
180 Ga0207686_10001014
181 Ga0207669_10725965
182 Ga0207711_10000458
183 Ga0207667_10092688
184 Ga0207667_10378362
185 Ga0207702_10001172
186 Ga0207648_10119603
187 Ga0207676_10117036
188 Ga0209281_1000518
189 Ga0209588_1243533
190 Ga0268266_10072236
191 Ga0265336_10020507
192 Ga0265338_10052298
193 Ga0316579_10000011
194 Ga0307516_10000762
195 Ga0373934_0005851
196 Ga0373953_0019888
197 Ga0373953_0031644
198 Ga0373954_0008147
199 Ga0373954_0051404
200 Ga0373954_0377471
201 Ga0373956_0008994
202 Ga0373956_0214883
203 Ga0373957_0034314
204 Ga0373957_0071747
205 Ga0373955_0179704
206 Ga0373924_0007331
207 Ga0373924_0027887
208 Ga0373933_0030905
209 Ga0373937_0179916
210 Ga0373937_0720709
211 Ga0395899_0029012
212 Ga0395899_0045782
213 Ga0395899_0115455
214 Ga0395900_0033560
215 Ga0395900_0776042
216 Ga0395898_0012719
217 Ga0395898_0021191
218 Ga0395898_0048416
219 Ga0395898_0793328
220 Ga0395905_0064030
221 Ga0395901_0051589
222 Ga0395901_0419592
223 Ga0395901_0866078
224 Ga0395901_1278555
225 Ga0466958_0410538
226 Ga0466967_2012262
227 Ga0495592_0011861
228 Ga0495592_0048265
229 Ga0495592_0358985
230 Ga0495651_0449321
231 Ga0495653_0005006
232 Ga0495653_0055991
233 Ga0495664_0077061
234 Ga0495664_0120767
235 Ga0495608_0180967
236 Ga0495618_0000101
237 Ga0495628_0037132
238 Ga0495630_0533865
239 Ga0495630_0543811
240 Ga0495632_0039140
241 Ga0495643_0004999
242 Ga0495652_0013706
243 Ga0495640_0010888
244 Ga0495640_0092659
245 Ga0495586_0047694
246 Ga0495586_0469032
247 Ga0495609_0081226
248 Ga0495645_0031567
249 Ga0495645_0604103
250 Ga0495667_0040007
251 Ga0495634_0073711
252 Ga0495634_0236132
253 Ga0495625_0005700
254 Ga0495635_0004232
255 Ga0495635_0014100
256 Ga0495599_0140238
257 Ga0495623_0041675
258 Ga0495646_0012039
259 Ga0495613_0003627
260 Ga0495604_0155201
261 Ga0495674_0034469
262 Ga0495674_0072940
263 Ga0495674_0852468
264 Ga0495675_0006756
265 Ga0495675_0013293
266 Ga0495675_0222547
267 Ga0495681_0141336
268 Ga0495684_0020870
269 Ga0495602_0076230
270 Ga0496104_0210663
271 Ga0496113_0454686
272 Ga0496114_0127163
273 Ga0496115_1073268
274 Ga0501043_0035730
275 Ga0501227_000320
276 nmdc:mga08y16_485832_c1
277 Ga0495601_0202049
278 Ga0495619_0133373
279 Ga0500616_0092211
280 Ga0500636_0002488
281 2513575473
282 2517094666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bv8-assembly1.cif.gz_B crystal structure of the phage mu protein mom inactive mutant s124a 0.8173 3 146
8bv8-assembly1.cif.gz_B crystal structure of the phage mu protein mom inactive mutant s124a 0.7975 3 146
8bv8-assembly1.cif.gz_A crystal structure of the phage mu protein mom inactive mutant s124a 0.7777 3 146
6ezd-assembly2.cif.gz_B pyrrolysyl-trna synthetase from canditatus methanomethylophilus alvus (mmapylrs) 0.773 2 49
8bv8-assembly1.cif.gz_A crystal structure of the phage mu protein mom inactive mutant s124a 0.7583 3 146
ID Description Score Start End Superfamily
af_A0A1D6LYK2_621_771_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7999 32 97 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7993 77 147 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7787 76 146 3.40.630.30
af_I1KF23_15_150_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.774 33 146 3.40.630.30
3r9eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7637 33 147 3.40.630.30
ID Description Score Start End GO Terms
AF-C5T0M3-F1-model_v4 Uncharacterized protein 0.9919 2 92
AF-X1FMT7-F1-model_v4 N-acetyltransferase domain-containing protein 0.9842 1 116
AF-X1FMT7-F1-model_v4 N-acetyltransferase domain-containing protein 0.9759 1 116
AF-A0A0C2RX17-F1-model_v4 deleted 0.968 2 124
AF-X8D9W3-F1-model_v4 Uncharacterized protein 0.9664 2 71

Map