F183603

General Info

Members Datasets Scaffolds Average Seq Length
141 92 282 129

Family's Representative Sequence

Representative Sequence 3300046475|Ga0495639_0670678|Ga0495639_0670678_15_455
Length 146
Sequence LVISLPAGVPAMTTDPVMEPATVHLAQMSTTSKHFARRLLTIGENRLELLMVEVQEERERLLHAILLALGVAVFGFLAGVALTVAIVVLLWHLWPVAVLLVLTSLYAAIGAYLYQRFSALQRDWKTLPATLDQLRKDRACLEATLE

Samples

Sample ID Description Type Environment
1 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
51 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
65 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
66 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
81 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
84 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
85 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
91 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
92 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.91
Metatranscriptomes 7.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 1.42
Rhizosphere 95.04
Stem 0
Stem Tuber 0
Unclassified 45.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495639_0670678 3300046475 Unclassified 535
2 rootH2_10049625 3300003320 Bacteria 27114
3 Ga0058860_11948396 3300004801 Bacteria 1385
4 Ga0058860_11988197 3300004801 Unclassified 632
5 Ga0068869_100646914 3300005334 Unclassified 897
6 Ga0070680_100830645 3300005336 Bacteria 796
7 Ga0070689_100527001 3300005340 Unclassified 1015
8 Ga0070689_101364374 3300005340 Unclassified 640
9 Ga0070687_100066641 3300005343 Bacteria 1919
10 Ga0070675_101663527 3300005354 Unclassified 589
11 Ga0070709_10162956 3300005434 Unclassified 1552
12 Ga0070714_101528041 3300005435 Unclassified 652
13 Ga0070713_100847993 3300005436 Unclassified 877
14 Ga0070678_100818836 3300005456 Unclassified 846
15 Ga0070681_10212053 3300005458 Unclassified 1853
16 Ga0070706_100321833 3300005467 Bacteria 1442
17 Ga0070679_100360542 3300005530 Unclassified 1401
18 Ga0070679_100917849 3300005530 Unclassified 819
19 Ga0070697_102011088 3300005536 Bacteria 517
20 Ga0070686_100248574 3300005544 Bacteria 1298
21 Ga0070695_100504913 3300005545 Unclassified 936
22 Ga0070665_101120629 3300005548 Unclassified 798
23 Ga0068855_100066649 3300005563 Bacteria 4197
24 Ga0068856_100020383 3300005614 Bacteria 6439
25 Ga0068856_100179312 3300005614 Unclassified 2131
26 Ga0068856_100366019 3300005614 Unclassified 1460
27 Ga0068859_100124000 3300005617 Bacteria 2651
28 Ga0068859_100545945 3300005617 Bacteria 1254
29 Ga0068859_100820000 3300005617 Bacteria 1017
30 Ga0068864_101038578 3300005618 Unclassified 814
31 Ga0075433_11026028 3300006852 Unclassified 718
32 Ga0097620_100124005 3300006931 Bacteria 2651
33 Ga0097620_100545971 3300006931 Bacteria 1254
34 Ga0097620_100819989 3300006931 Bacteria 1017
35 Ga0105240_10075085 3300009093 Bacteria 4170
36 Ga0105240_10162010 3300009093 Bacteria 2656
37 Ga0105240_10934322 3300009093 Unclassified 931
38 Ga0105237_10097210 3300009545 Bacteria 2935
39 Ga0105238_10003104 3300009551 Bacteria 16568
40 Ga0105238_10024181 3300009551 Bacteria 6194
41 Ga0105238_10109811 3300009551 Bacteria 2739
42 Ga0105238_10896377 3300009551 Unclassified 905
43 Ga0157370_10265612 3300013104 Unclassified 1585
44 Ga0157374_10535850 3300013296 Unclassified 1178
45 Ga0157378_10422366 3300013297 Unclassified 1318
46 Ga0157372_10025870 3300013307 Bacteria 6383
47 Ga0157372_10049506 3300013307 Unclassified 4672
48 Ga0157375_13295542 3300013308 Unclassified 538
49 Ga0207695_10038822 3300025913 Bacteria 5121
50 Ga0207695_11039966 3300025913 Unclassified 698
51 Ga0207671_10645315 3300025914 Bacteria 843
52 Ga0207662_10088822 3300025918 Bacteria 1898
53 Ga0207652_10508232 3300025921 Unclassified 1084
54 Ga0207694_10030566 3300025924 Bacteria 4114
55 Ga0207694_10035085 3300025924 Unclassified 3847
56 Ga0207694_10690035 3300025924 Unclassified 861
57 Ga0207667_10023921 3300025949 Bacteria 6720
58 Ga0207639_10592384 3300026041 Bacteria 1022
59 Ga0207702_10007211 3300026078 Bacteria 9512
60 Ga0207702_10317287 3300026078 Unclassified 1483
61 Ga0207702_10499129 3300026078 Bacteria 1186
62 Ga0207683_10767450 3300026121 Unclassified 895
63 Ga0207698_10509129 3300026142 Unclassified 1173
64 Ga0265337_1002601 3300028556 Bacteria 8164
65 Ga0265319_1000007 3300028563 Bacteria 217194
66 Ga0265319_1020840 3300028563 Unclassified 2418
67 Ga0265319_1029705 3300028563 Bacteria 1917
68 Ga0265319_1194013 3300028563 Unclassified 624
69 Ga0265334_10065470 3300028573 Bacteria 1363
70 Ga0265323_10048874 3300028653 Unclassified 1507
71 Ga0265336_10005252 3300028666 Unclassified 4799
72 Ga0265336_10006017 3300028666 Unclassified 4417
73 Ga0265336_10060025 3300028666 Bacteria 1141
74 Ga0265338_10002262 3300028800 Bacteria 29330
75 Ga0265338_10004397 3300028800 Bacteria 19064
76 Ga0265338_10006885 3300028800 Bacteria 14308
77 Ga0265338_10026621 3300028800 Bacteria 5826
78 Ga0265338_10069457 3300028800 Bacteria 3026
79 Ga0265338_10323413 3300028800 Bacteria 1116
80 Ga0265324_10057390 3300029957 Bacteria 1333
81 Ga0265324_10084056 3300029957 Bacteria 1083
82 Ga0265775_102198 3300030762 Bacteria 994
83 Ga0265777_102053 3300030877 Bacteria 1134
84 Ga0265777_104165 3300030877 Unclassified 915
85 Ga0265776_101937 3300030880 Unclassified 922
86 Ga0265779_108646 3300031043 Bacteria 598
87 Ga0265328_10039527 3300031239 Unclassified 1740
88 Ga0265320_10042700 3300031240 Bacteria 2247
89 Ga0265320_10072889 3300031240 Bacteria 1615
90 Ga0265320_10119429 3300031240 Unclassified 1203
91 Ga0265329_10007349 3300031242 Unclassified 4273
92 Ga0265329_10102905 3300031242 Bacteria 910
93 Ga0265340_10056161 3300031247 Bacteria 1895
94 Ga0265340_10352931 3300031247 Unclassified 650
95 Ga0265339_10140618 3300031249 Bacteria 1228
96 Ga0265327_10004231 3300031251 Bacteria 12880
97 Ga0265327_10042535 3300031251 Bacteria 2438
98 Ga0265316_10001644 3300031344 Bacteria 23838
99 Ga0265316_10027729 3300031344 Bacteria 4683
100 Ga0265316_10048836 3300031344 Bacteria 3337
101 Ga0265316_10307871 3300031344 Bacteria 1153
102 Ga0265316_10378153 3300031344 Unclassified 1022
103 Ga0265313_10006484 3300031595 Bacteria 8269
104 Ga0265313_10205936 3300031595 Unclassified 817
105 Ga0265314_10000304 3300031711 Bacteria 70430
106 Ga0373934_0067940 3300035086 Unclassified 1424
107 Ga0373957_0074945 3300035120 Unclassified 1329
108 Ga0373933_0121389 3300035724 Bacteria 1637
109 Ga0373947_0910527 3300035725 Unclassified 600
110 Ga0373937_0376912 3300036401 Bacteria 1345
111 Ga0373937_0861027 3300036401 Unclassified 855
112 Ga0265778_015585 3300036457 Bacteria 905
113 Ga0265778_016674 3300036457 Unclassified 882
114 Ga0265778_020472 3300036457 Unclassified 814
115 Ga0451798_0332900 3300041458 Unclassified 958
116 Ga0451577_0006726 3300042876 Bacteria 11410
117 Ga0451577_0769252 3300042876 Bacteria 871
118 Ga0453684_0067618 3300044712 Bacteria 4543
119 Ga0453684_0128262 3300044712 Unclassified 3049
120 Ga0453684_2192609 3300044712 Unclassified 552
121 Ga0451576_0054005 3300045051 Bacteria 4207
122 Ga0495592_0047737 3300046454 Bacteria 3188
123 Ga0495639_0644552 3300046475 Unclassified 546
124 Ga0495664_0073681 3300046477 Bacteria 2042
125 Ga0495628_0206476 3300046516 Bacteria 1479
126 Ga0495630_0100670 3300046517 Bacteria 2186
127 Ga0495586_0706978 3300046535 Unclassified 582
128 Ga0495587_0125048 3300046536 Bacteria 1472
129 Ga0495645_0335632 3300046543 Bacteria 977
130 Ga0495656_0262758 3300046615 Unclassified 875
131 Ga0495657_0350425 3300046675 Unclassified 874
132 Ga0495599_0096986 3300046678 Bacteria 1838
133 Ga0495623_0659630 3300046679 Unclassified 539
134 Ga0495600_0319799 3300046809 Unclassified 976
135 Ga0495674_0027191 3300047319 Bacteria 5229
136 Ga0495676_0387514 3300047321 Unclassified 929
137 Ga0495684_0131605 3300047471 Unclassified 1879
138 Ga0496107_0173432 3300048910 Unclassified 1601
139 Ga0495601_0533930 3300053077 Bacteria 756
140 Ga0500650_0152966 3300053098 Bacteria 1066
141 Ga0500636_0128414 3300053177 Bacteria 1415
142 Ga0495639_0670678
143 rootH2_10049625
144 Ga0058860_11948396
145 Ga0058860_11988197
146 Ga0068869_100646914
147 Ga0070680_100830645
148 Ga0070689_100527001
149 Ga0070689_101364374
150 Ga0070687_100066641
151 Ga0070675_101663527
152 Ga0070709_10162956
153 Ga0070714_101528041
154 Ga0070713_100847993
155 Ga0070678_100818836
156 Ga0070681_10212053
157 Ga0070706_100321833
158 Ga0070679_100360542
159 Ga0070679_100917849
160 Ga0070697_102011088
161 Ga0070686_100248574
162 Ga0070695_100504913
163 Ga0070665_101120629
164 Ga0068855_100066649
165 Ga0068856_100020383
166 Ga0068856_100179312
167 Ga0068856_100366019
168 Ga0068859_100124000
169 Ga0068859_100545945
170 Ga0068859_100820000
171 Ga0068864_101038578
172 Ga0075433_11026028
173 Ga0097620_100124005
174 Ga0097620_100545971
175 Ga0097620_100819989
176 Ga0105240_10075085
177 Ga0105240_10162010
178 Ga0105240_10934322
179 Ga0105237_10097210
180 Ga0105238_10003104
181 Ga0105238_10024181
182 Ga0105238_10109811
183 Ga0105238_10896377
184 Ga0157370_10265612
185 Ga0157374_10535850
186 Ga0157378_10422366
187 Ga0157372_10025870
188 Ga0157372_10049506
189 Ga0157375_13295542
190 Ga0207695_10038822
191 Ga0207695_11039966
192 Ga0207671_10645315
193 Ga0207662_10088822
194 Ga0207652_10508232
195 Ga0207694_10030566
196 Ga0207694_10035085
197 Ga0207694_10690035
198 Ga0207667_10023921
199 Ga0207639_10592384
200 Ga0207702_10007211
201 Ga0207702_10317287
202 Ga0207702_10499129
203 Ga0207683_10767450
204 Ga0207698_10509129
205 Ga0265337_1002601
206 Ga0265319_1000007
207 Ga0265319_1020840
208 Ga0265319_1029705
209 Ga0265319_1194013
210 Ga0265334_10065470
211 Ga0265323_10048874
212 Ga0265336_10005252
213 Ga0265336_10006017
214 Ga0265336_10060025
215 Ga0265338_10002262
216 Ga0265338_10004397
217 Ga0265338_10006885
218 Ga0265338_10026621
219 Ga0265338_10069457
220 Ga0265338_10323413
221 Ga0265324_10057390
222 Ga0265324_10084056
223 Ga0265775_102198
224 Ga0265777_102053
225 Ga0265777_104165
226 Ga0265776_101937
227 Ga0265779_108646
228 Ga0265328_10039527
229 Ga0265320_10042700
230 Ga0265320_10072889
231 Ga0265320_10119429
232 Ga0265329_10007349
233 Ga0265329_10102905
234 Ga0265340_10056161
235 Ga0265340_10352931
236 Ga0265339_10140618
237 Ga0265327_10004231
238 Ga0265327_10042535
239 Ga0265316_10001644
240 Ga0265316_10027729
241 Ga0265316_10048836
242 Ga0265316_10307871
243 Ga0265316_10378153
244 Ga0265313_10006484
245 Ga0265313_10205936
246 Ga0265314_10000304
247 Ga0373934_0067940
248 Ga0373957_0074945
249 Ga0373933_0121389
250 Ga0373947_0910527
251 Ga0373937_0376912
252 Ga0373937_0861027
253 Ga0265778_015585
254 Ga0265778_016674
255 Ga0265778_020472
256 Ga0451798_0332900
257 Ga0451577_0006726
258 Ga0451577_0769252
259 Ga0453684_0067618
260 Ga0453684_0128262
261 Ga0453684_2192609
262 Ga0451576_0054005
263 Ga0495592_0047737
264 Ga0495639_0644552
265 Ga0495664_0073681
266 Ga0495628_0206476
267 Ga0495630_0100670
268 Ga0495586_0706978
269 Ga0495587_0125048
270 Ga0495645_0335632
271 Ga0495656_0262758
272 Ga0495657_0350425
273 Ga0495599_0096986
274 Ga0495623_0659630
275 Ga0495600_0319799
276 Ga0495674_0027191
277 Ga0495676_0387514
278 Ga0495684_0131605
279 Ga0496107_0173432
280 Ga0495601_0533930
281 Ga0500650_0152966
282 Ga0500636_0128414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07332

Phage_holin_3_6

Putative Actinobacterial Holin-X, holin superfamily III

30

142

0.85

Map