F183531

General Info

Members Datasets Scaffolds Average Seq Length
141 69 282 198

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0160061|Ga0466967_0160061_1139_1747
Length 188
Sequence VDDADVAFDERGLVPCIVQDWRSGEVLTLAYMNAESLALTRQTGEVHFFSRSRQELWHKGATSGNTMAVRAIRYDCDGDALLALVEPSGPACHTGERTCFHRGDLEPQAPGEVLGEGSYTVTLLDDPALAGAKVQEEAEEVVRAVREESDERVAEEGADVLYHLAVLMRGRNLSLADAERVLDGRRQR

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
8 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
9 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
10 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
11 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
13 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
14 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
15 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
16 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
17 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
18 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
19 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
20 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
30 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
31 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
32 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
33 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
34 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
35 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
38 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
39 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
40 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
41 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
42 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
43 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
44 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
45 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
46 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
47 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
52 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
53 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
54 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
55 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
56 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
57 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
58 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
59 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
60 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
63 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
64 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
65 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
66 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
67 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
68 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
69 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 2.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.96
Rhizosphere 70.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0160061 3300045976 Bacteria 2112
2 Ga0070714_100028728 3300005435 Bacteria 4617
3 Ga0070714_100577906 3300005435 Bacteria 1078
4 Ga0070714_100692798 3300005435 Bacteria 983
5 Ga0070713_100019333 3300005436 Bacteria 5197
6 Ga0070713_100396531 3300005436 Bacteria 1288
7 Ga0070713_100666342 3300005436 Bacteria 992
8 Ga0070710_10068384 3300005437 Bacteria 2040
9 Ga0070711_100039643 3300005439 Bacteria 3174
10 Ga0081455_10159324 3300005937 Bacteria 1732
11 Ga0081455_10284725 3300005937 Bacteria 1192
12 Ga0070717_10009514 3300006028 Bacteria 7309
13 Ga0070717_10060133 3300006028 Bacteria 3145
14 Ga0070717_10308581 3300006028 Bacteria 1408
15 Ga0070717_10610325 3300006028 Bacteria 990
16 Ga0070716_100018509 3300006173 Bacteria 3631
17 Ga0070716_100047661 3300006173 Bacteria 2419
18 Ga0070712_100074416 3300006175 Bacteria 2440
19 Ga0099795_10308077 3300007788 Bacteria 698
20 Ga0111539_10269813 3300009094 Bacteria 1981
21 Ga0105237_10000495 3300009545 Bacteria 55778
22 Ga0105237_10666880 3300009545 Bacteria 1047
23 Ga0157378_10324209 3300013297 Bacteria 1497
24 Ga0206356_10436189 3300020070 Bacteria 1396
25 Ga0206353_11160192 3300020082 Bacteria 1438
26 Ga0206353_11807824 3300020082 Bacteria 867
27 Ga0213873_10071429 3300021358 Bacteria 957
28 Ga0213874_10000224 3300021377 Bacteria 10546
29 Ga0213874_10039437 3300021377 Bacteria 1407
30 Ga0213876_10007971 3300021384 Bacteria 5744
31 Ga0213876_10017771 3300021384 Bacteria 3753
32 Ga0213876_10020197 3300021384 Bacteria 3520
33 Ga0213876_10113379 3300021384 Bacteria 1439
34 Ga0213876_10229633 3300021384 Bacteria 986
35 Ga0213875_10005809 3300021388 Bacteria 6566
36 Ga0213875_10016962 3300021388 Bacteria 3525
37 Ga0213875_10030163 3300021388 Bacteria 2569
38 Ga0213875_10033604 3300021388 Bacteria 2423
39 Ga0213875_10104235 3300021388 Bacteria 1324
40 Ga0207692_10054242 3300025898 Bacteria 2046
41 Ga0207699_10030069 3300025906 Bacteria 3036
42 Ga0207671_10004070 3300025914 Bacteria 14163
43 Ga0207693_10001859 3300025915 Bacteria 18493
44 Ga0207693_10196852 3300025915 Bacteria 1585
45 Ga0207663_10001258 3300025916 Bacteria 11742
46 Ga0207663_10036294 3300025916 Bacteria 2965
47 Ga0207646_10328571 3300025922 Bacteria 1381
48 Ga0207664_10014994 3300025929 Bacteria 5613
49 Ga0207664_10105089 3300025929 Bacteria 2340
50 Ga0207664_10289586 3300025929 Bacteria 1439
51 Ga0207664_10305324 3300025929 Bacteria 1401
52 Ga0207665_10173919 3300025939 Bacteria 1556
53 Ga0207661_10193354 3300025944 Bacteria 1785
54 Ga0207428_10056397 3300027907 Bacteria 3122
55 Ga0265319_1001839 3300028563 Bacteria 12100
56 Ga0265338_10037862 3300028800 Bacteria 4580
57 Ga0265320_10014210 3300031240 Bacteria 4544
58 Ga0265320_10122335 3300031240 Bacteria 1186
59 Ga0265316_10119850 3300031344 Bacteria 1988
60 Ga0265314_10067205 3300031711 Bacteria 2415
61 Ga0307407_10105433 3300031903 Bacteria 1759
62 Ga0307416_100171762 3300032002 Bacteria 2019
63 Ga0307415_100029785 3300032126 Bacteria 3493
64 Ga0307415_100455330 3300032126 Bacteria 1107
65 Ga0307415_101201930 3300032126 Bacteria 714
66 Ga0436364_0172091 3300037853 Bacteria 4871
67 Ga0436364_0231092 3300037853 Bacteria 1151
68 Ga0436364_0304426 3300037853 Bacteria 960
69 Ga0436364_0358577 3300037853 Bacteria 27430
70 Ga0436364_0690446 3300037853 Bacteria 17320
71 Ga0436364_0840900 3300037853 Bacteria 42362
72 Ga0436364_1006666 3300037853 Bacteria 7981
73 Ga0436365_0025272 3300039437 Bacteria 37971
74 Ga0436365_0148921 3300039437 Bacteria 4424
75 Ga0436365_0596163 3300039437 Bacteria 2664
76 Ga0436365_1009380 3300039437 Bacteria 2824
77 Ga0436365_1135992 3300039437 Bacteria 1563
78 Ga0436365_1255814 3300039437 Bacteria 3968
79 Ga0436365_1269239 3300039437 Bacteria 1329
80 Ga0436365_1748676 3300039437 Bacteria 11932
81 Ga0436363_0023518 3300039450 Bacteria 29320
82 Ga0436363_0026942 3300039450 Bacteria 2302
83 Ga0436363_0336033 3300039450 Bacteria 945
84 Ga0436363_0422967 3300039450 Bacteria 692
85 Ga0436363_1120974 3300039450 Bacteria 3954
86 Ga0436363_1254012 3300039450 Bacteria 1334
87 Ga0436362_0661340 3300039453 Bacteria 1409
88 Ga0436362_1001948 3300039453 Bacteria 1802
89 Ga0466969_0055676 3300044656 Bacteria 1934
90 Ga0466966_0024700 3300044684 Bacteria 3931
91 Ga0466966_0151170 3300044684 Bacteria 1416
92 Ga0466961_0089531 3300044693 Bacteria 1943
93 Ga0466961_0473592 3300044693 Bacteria 757
94 Ga0466963_0008052 3300044694 Bacteria 6309
95 Ga0466963_0015053 3300044694 Bacteria 4782
96 Ga0466971_0056107 3300044719 Bacteria 1777
97 Ga0466971_0082035 3300044719 Bacteria 1472
98 Ga0466968_0140367 3300044735 Bacteria 1105
99 Ga0466970_0033449 3300044765 Bacteria 2718
100 Ga0466970_0138679 3300044765 Bacteria 1339
101 Ga0466957_0031319 3300044842 Bacteria 3178
102 Ga0466957_0220087 3300044842 Bacteria 1253
103 Ga0466957_0541768 3300044842 Bacteria 810
104 Ga0466959_0001955 3300045049 Bacteria 12985
105 Ga0466959_0010919 3300045049 Bacteria 6512
106 Ga0466959_0082592 3300045049 Bacteria 2315
107 Ga0466959_0208819 3300045049 Bacteria 1357
108 Ga0466959_0295328 3300045049 Bacteria 1110
109 Ga0466959_0343100 3300045049 Bacteria 1019
110 Ga0466958_0001371 3300045836 Bacteria 11507
111 Ga0466958_0001679 3300045836 Bacteria 10684
112 Ga0466958_0008899 3300045836 Bacteria 5577
113 Ga0466958_0013042 3300045836 Bacteria 4723
114 Ga0466958_0034233 3300045836 Bacteria 3030
115 Ga0466958_0181405 3300045836 Bacteria 1336
116 Ga0466958_0222606 3300045836 Bacteria 1204
117 Ga0466958_0247233 3300045836 Bacteria 1140
118 Ga0466967_0019662 3300045976 Bacteria 5438
119 Ga0466967_0987498 3300045976 Bacteria 838
120 Ga0495629_0773445 3300046459 Bacteria 634
121 Ga0495618_0000033 3300046514 Bacteria 104345
122 Ga0495652_0046886 3300046529 Bacteria 3709
123 Ga0495652_0342484 3300046529 Bacteria 1073
124 Ga0495665_0278828 3300046531 Bacteria 858
125 Ga0495604_0000057 3300047317 Bacteria 98770
126 Ga0495684_0002470 3300047471 Bacteria 14743
127 Ga0495602_0277306 3300048088 Bacteria 1237
128 Ga0495602_0321441 3300048088 Bacteria 1126
129 Ga0496100_0707179 3300048903 Bacteria 787
130 Ga0496104_0000028 3300048907 Bacteria 203377
131 Ga0496104_0509581 3300048907 Bacteria 1114
132 Ga0496110_0001201 3300048913 Bacteria 18430
133 Ga0496111_0000187 3300048914 Bacteria 28438
134 Ga0496114_0097131 3300048917 Bacteria 2509
135 Ga0496115_0000012 3300048918 Bacteria 215509
136 Ga0496126_0969505 3300048929 Bacteria 640
137 nmdc:mga08y16_276778_c1 3300050511 Bacteria 1732
138 nmdc:mga0n895_567390_c1 3300050512 Bacteria 1140
139 Ga0495612_0000153 3300053078 Bacteria 28809
140 Ga0466962_0011369 3300061719 Bacteria 4287
141 Ga0466962_0034663 3300061719 Bacteria 2416
142 Ga0466967_0160061
143 Ga0070714_100028728
144 Ga0070714_100577906
145 Ga0070714_100692798
146 Ga0070713_100019333
147 Ga0070713_100396531
148 Ga0070713_100666342
149 Ga0070710_10068384
150 Ga0070711_100039643
151 Ga0081455_10159324
152 Ga0081455_10284725
153 Ga0070717_10009514
154 Ga0070717_10060133
155 Ga0070717_10308581
156 Ga0070717_10610325
157 Ga0070716_100018509
158 Ga0070716_100047661
159 Ga0070712_100074416
160 Ga0099795_10308077
161 Ga0111539_10269813
162 Ga0105237_10000495
163 Ga0105237_10666880
164 Ga0157378_10324209
165 Ga0206356_10436189
166 Ga0206353_11160192
167 Ga0206353_11807824
168 Ga0213873_10071429
169 Ga0213874_10000224
170 Ga0213874_10039437
171 Ga0213876_10007971
172 Ga0213876_10017771
173 Ga0213876_10020197
174 Ga0213876_10113379
175 Ga0213876_10229633
176 Ga0213875_10005809
177 Ga0213875_10016962
178 Ga0213875_10030163
179 Ga0213875_10033604
180 Ga0213875_10104235
181 Ga0207692_10054242
182 Ga0207699_10030069
183 Ga0207671_10004070
184 Ga0207693_10001859
185 Ga0207693_10196852
186 Ga0207663_10001258
187 Ga0207663_10036294
188 Ga0207646_10328571
189 Ga0207664_10014994
190 Ga0207664_10105089
191 Ga0207664_10289586
192 Ga0207664_10305324
193 Ga0207665_10173919
194 Ga0207661_10193354
195 Ga0207428_10056397
196 Ga0265319_1001839
197 Ga0265338_10037862
198 Ga0265320_10014210
199 Ga0265320_10122335
200 Ga0265316_10119850
201 Ga0265314_10067205
202 Ga0307407_10105433
203 Ga0307416_100171762
204 Ga0307415_100029785
205 Ga0307415_100455330
206 Ga0307415_101201930
207 Ga0436364_0172091
208 Ga0436364_0231092
209 Ga0436364_0304426
210 Ga0436364_0358577
211 Ga0436364_0690446
212 Ga0436364_0840900
213 Ga0436364_1006666
214 Ga0436365_0025272
215 Ga0436365_0148921
216 Ga0436365_0596163
217 Ga0436365_1009380
218 Ga0436365_1135992
219 Ga0436365_1255814
220 Ga0436365_1269239
221 Ga0436365_1748676
222 Ga0436363_0023518
223 Ga0436363_0026942
224 Ga0436363_0336033
225 Ga0436363_0422967
226 Ga0436363_1120974
227 Ga0436363_1254012
228 Ga0436362_0661340
229 Ga0436362_1001948
230 Ga0466969_0055676
231 Ga0466966_0024700
232 Ga0466966_0151170
233 Ga0466961_0089531
234 Ga0466961_0473592
235 Ga0466963_0008052
236 Ga0466963_0015053
237 Ga0466971_0056107
238 Ga0466971_0082035
239 Ga0466968_0140367
240 Ga0466970_0033449
241 Ga0466970_0138679
242 Ga0466957_0031319
243 Ga0466957_0220087
244 Ga0466957_0541768
245 Ga0466959_0001955
246 Ga0466959_0010919
247 Ga0466959_0082592
248 Ga0466959_0208819
249 Ga0466959_0295328
250 Ga0466959_0343100
251 Ga0466958_0001371
252 Ga0466958_0001679
253 Ga0466958_0008899
254 Ga0466958_0013042
255 Ga0466958_0034233
256 Ga0466958_0181405
257 Ga0466958_0222606
258 Ga0466958_0247233
259 Ga0466967_0019662
260 Ga0466967_0987498
261 Ga0495629_0773445
262 Ga0495618_0000033
263 Ga0495652_0046886
264 Ga0495652_0342484
265 Ga0495665_0278828
266 Ga0495604_0000057
267 Ga0495684_0002470
268 Ga0495602_0277306
269 Ga0495602_0321441
270 Ga0496100_0707179
271 Ga0496104_0000028
272 Ga0496104_0509581
273 Ga0496110_0001201
274 Ga0496111_0000187
275 Ga0496114_0097131
276 Ga0496115_0000012
277 Ga0496126_0969505
278 nmdc:mga08y16_276778_c1
279 nmdc:mga0n895_567390_c1
280 Ga0495612_0000153
281 Ga0466962_0011369
282 Ga0466962_0034663

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

28

101

0.99

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

112

186

0.94

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

127

184

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zps-assembly1.cif.gz_A crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi 0.9768 8 95
3c90-assembly1.cif.gz_X the 1.25 a resolution structure of phosphoribosyl-atp pyrophosphohydrolase from mycobacterium tuberculosis, crystal form ii 0.9434 109 189
7aoi-assembly1.cif.gz_XF trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.9407 135 179
7qnl-assembly1.cif.gz_AAA lov2-darpin fusion - d4_deltalov 0.9145 132 180
1yvw-assembly1.cif.gz_A crystal structure of phosphoribosyl-atp pyrophosphohydrolase from bacillus cereus. nesgc target bcr13. 0.9092 109 196
ID Description Score Start End Superfamily
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9849 8 87 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9801 1 87 3.10.20.810
af_K7K2K1_122_247_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9746 139 181 1.20.1270.60
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9727 1 87 3.10.20.810
af_O59667_301_389_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9498 109 197 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A7W1SMB6-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 1.002 1 83 GO:0000105
GO:0004635
AF-A0A7K4FBC3-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 1.002 6 76 GO:0000105
GO:0004635
AF-A0A7R8WX10-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 1.001 1 81 GO:0000105
GO:0004635
AF-A0A1F6U139-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 1.001 1 84 GO:0000105
GO:0004635
AF-A0A3M2FVE2-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 1.001 1 84 GO:0000105
GO:0004635

Map