F183385

General Info

Members Datasets Scaffolds Average Seq Length
141 99 282 122

Family's Representative Sequence

Representative Sequence 3300041458|Ga0451798_1038640|Ga0451798_1038640_19_450
Length 143
Sequence LNLPDLGLIFGIYKNPVNLEITAMHFTKLVPEIYYADIKSGLKTFVECLEFSIGHDELNSDTPFCVVGKDGMSVMLFQNKEYAEKYNPLLRLVTNNIEEVYQKVASKYPELLHPNLNKITLRPWGAKEFALLDGQIGIVIQQW

Samples

Sample ID Description Type Environment
1 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
64 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
65 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
66 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
67 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
79 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
80 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
81 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
82 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
83 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
84 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
85 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
86 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
87 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
88 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
89 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
90 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
91 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
92 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
93 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
94 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
95 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
96 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
97 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
98 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
99 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.64
Nodule 0
Rhizoplane 2.84
Rhizosphere 76.6
Stem 0
Stem Tuber 0
Unclassified 21.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451798_1038640 3300041458 Bacteria 618
2 rootH1_10121055 3300003316 Bacteria 2654
3 rootH2_10135988 3300003320 Unclassified 1501
4 rootL2_10030644 3300003322 Bacteria 10445
5 rootL2_10160322 3300003322 Bacteria 1680
6 rootL2_10160323 3300003322 Bacteria 1817
7 rootH1_10021132 3300003323 Bacteria 13990
8 rootH1_10057976 3300003323 Bacteria 3383
9 rootH1_10105760 3300003323 Bacteria 4119
10 Ga0070658_10694752 3300005327 Bacteria 883
11 Ga0070682_100290653 3300005337 Unclassified 1195
12 Ga0070682_100544242 3300005337 Unclassified 907
13 Ga0070682_101437638 3300005337 Bacteria 591
14 Ga0070668_100589369 3300005347 Bacteria 971
15 Ga0070671_101053743 3300005355 Bacteria 713
16 Ga0070673_101236698 3300005364 Unclassified 700
17 Ga0070673_101628323 3300005364 Bacteria 610
18 Ga0070667_100528995 3300005367 Unclassified 1082
19 Ga0070678_100607289 3300005456 Bacteria 977
20 Ga0068853_100182223 3300005539 Bacteria 1905
21 Ga0070665_100159960 3300005548 Bacteria 2254
22 Ga0068855_100101910 3300005563 Bacteria 3304
23 Ga0068855_102385298 3300005563 Unclassified 528
24 Ga0068857_101306520 3300005577 Bacteria 704
25 Ga0068856_100039135 3300005614 Bacteria 4656
26 Ga0068866_10049840 3300005718 Bacteria 2124
27 Ga0068863_101157146 3300005841 Bacteria 779
28 Ga0075366_10405452 3300006195 Bacteria 839
29 Ga0075366_10507205 3300006195 Bacteria 746
30 Ga0097621_100344781 3300006237 Bacteria 1323
31 Ga0097621_100402701 3300006237 Bacteria 1225
32 Ga0075370_10560420 3300006353 Bacteria 691
33 Ga0068871_100525988 3300006358 Bacteria 1069
34 Ga0068871_100648922 3300006358 Unclassified 963
35 Ga0068871_100878001 3300006358 Bacteria 830
36 Ga0105240_10000276 3300009093 Bacteria 101817
37 Ga0105240_10094046 3300009093 Bacteria 3657
38 Ga0105240_10336145 3300009093 Bacteria 1717
39 Ga0105240_10679376 3300009093 Bacteria 1126
40 Ga0105240_11914662 3300009093 Unclassified 617
41 Ga0105241_10007888 3300009174 Bacteria 7825
42 Ga0105241_10022149 3300009174 Unclassified 4703
43 Ga0105241_10164466 3300009174 Unclassified 1827
44 Ga0105242_13327076 3300009176 Unclassified 500
45 Ga0105237_10030371 3300009545 Bacteria 5489
46 Ga0105237_10087852 3300009545 Bacteria 3098
47 Ga0105237_10238821 3300009545 Bacteria 1818
48 Ga0105237_11621092 3300009545 Unclassified 654
49 Ga0105238_10002054 3300009551 Bacteria 20324
50 Ga0105239_10000263 3300010375 Bacteria 78014
51 Ga0105239_10035330 3300010375 Bacteria 5489
52 Ga0105239_10338182 3300010375 Bacteria 1698
53 Ga0105239_10556469 3300010375 Unclassified 1306
54 Ga0157370_10128249 3300013104 Unclassified 2367
55 Ga0157369_10961024 3300013105 Bacteria 875
56 Ga0157374_12196663 3300013296 Bacteria 579
57 Ga0157378_10999364 3300013297 Bacteria 871
58 Ga0157378_11489140 3300013297 Bacteria 721
59 Ga0157378_11531819 3300013297 Bacteria 712
60 Ga0163162_10296484 3300013306 Unclassified 1749
61 Ga0157372_10003071 3300013307 Bacteria 17982
62 Ga0157372_10141420 3300013307 Bacteria 2772
63 Ga0157372_10332413 3300013307 Bacteria 1770
64 Ga0157375_10929223 3300013308 Bacteria 1013
65 Ga0163163_10521078 3300014325 Bacteria 1251
66 Ga0163163_12576818 3300014325 Unclassified 566
67 Ga0157380_10211617 3300014326 Bacteria 1728
68 Ga0157377_11430436 3300014745 Bacteria 546
69 Ga0157379_10973533 3300014968 Bacteria 808
70 Ga0157379_11088286 3300014968 Unclassified 765
71 Ga0157376_10715379 3300014969 Bacteria 1008
72 Ga0207647_10052863 3300025904 Bacteria 2506
73 Ga0207647_10195401 3300025904 Bacteria 1171
74 Ga0207647_10737238 3300025904 Unclassified 534
75 Ga0207654_10030561 3300025911 Unclassified 2959
76 Ga0207654_10068658 3300025911 Bacteria 2097
77 Ga0207695_10000456 3300025913 Bacteria 89131
78 Ga0207695_10078335 3300025913 Unclassified 3353
79 Ga0207695_10373206 3300025913 Bacteria 1313
80 Ga0207671_10049791 3300025914 Unclassified 3102
81 Ga0207671_10701515 3300025914 Bacteria 805
82 Ga0207694_10140174 3300025924 Bacteria 1944
83 Ga0207650_11859437 3300025925 Bacteria 509
84 Ga0207667_10140168 3300025949 Bacteria 2490
85 Ga0207667_10164146 3300025949 Unclassified 2284
86 Ga0207651_10970089 3300025960 Unclassified 759
87 Ga0207651_12038541 3300025960 Bacteria 515
88 Ga0207668_10198324 3300025972 Bacteria 1596
89 Ga0207658_10714533 3300025986 Unclassified 906
90 Ga0207639_10108065 3300026041 Bacteria 2261
91 Ga0207702_10037031 3300026078 Bacteria 4082
92 Ga0207641_11025216 3300026088 Bacteria 822
93 Ga0207674_10038634 3300026116 Bacteria 4951
94 Ga0207683_10209771 3300026121 Bacteria 1773
95 Ga0268265_11052339 3300028380 Bacteria 806
96 Ga0268264_10217590 3300028381 Bacteria 1757
97 Ga0307515_10000193 3300028794 Bacteria 148602
98 Ga0265327_10022787 3300031251 Unclassified 3730
99 Ga0307513_10312219 3300031456 Bacteria 1334
100 Ga0307507_10444767 3300033179 Unclassified 718
101 Ga0373927_0088892 3300035695 Unclassified 2006
102 Ga0451793_1418332 3300041452 Bacteria 565
103 Ga0451800_1598427 3300041459 Bacteria 731
104 Ga0451802_0185839 3300041460 Bacteria 1107
105 Ga0451851_1188781 3300041507 Bacteria 898
106 Ga0466969_0000102 3300044656 Bacteria 45137
107 Ga0466972_0000668 3300044658 Bacteria 16517
108 Ga0466966_0000018 3300044684 Bacteria 122605
109 Ga0466961_0038256 3300044693 Bacteria 3077
110 Ga0466961_0195251 3300044693 Bacteria 1253
111 Ga0466961_0635309 3300044693 Unclassified 641
112 Ga0466964_0328566 3300044706 Bacteria 779
113 Ga0466971_0038240 3300044719 Bacteria 2153
114 Ga0466968_0190417 3300044735 Bacteria 957
115 Ga0466970_0254276 3300044765 Bacteria 985
116 Ga0466959_0000002 3300045049 Bacteria 362671
117 Ga0466959_0032780 3300045049 Bacteria 3845
118 Ga0466958_0030466 3300045836 Bacteria 3206
119 Ga0495611_0021462 3300046648 Bacteria 2789
120 Ga0501198_005097 3300049649 Unclassified 1839
121 Ga0501222_008280 3300049662 Bacteria 1381
122 Ga0501233_083437 3300049668 Bacteria 826
123 Ga0501242_001003 3300049674 Bacteria 2734
124 Ga0501225_0007023 3300049705 Bacteria 3277
125 Ga0501278_017449 3300049774 Bacteria 634
126 nmdc:mga0k408_227926_c1 3300050493 Bacteria 1112
127 nmdc:mga0k408_410817_c1 3300050493 Bacteria 805
128 Ga0500635_0000414 3300053080 Bacteria 12646
129 Ga0500578_0291724 3300053086 Unclassified 970
130 Ga0500583_0001253 3300053092 Bacteria 7246
131 Ga0500642_0147148 3300053130 Bacteria 1105
132 Ga0500655_003463 3300053133 Bacteria 2850
133 Ga0500568_0003130 3300053139 Bacteria 9436
134 Ga0500577_0549580 3300053142 Unclassified 504
135 Ga0500604_0004318 3300053151 Bacteria 3774
136 Ga0500622_0002806 3300053156 Bacteria 12242
137 Ga0500611_000005 3300053727 Bacteria 228837
138 Ga0590075_054165 3300059424 Bacteria 1030
139 Ga0466962_0052760 3300061719 Bacteria 1943
140 2929922948 2929921140 Bacteria 8649150
141 8003152287 8003151029 Bacteria 8187759
142 Ga0451798_1038640
143 rootH1_10121055
144 rootH2_10135988
145 rootL2_10030644
146 rootL2_10160322
147 rootL2_10160323
148 rootH1_10021132
149 rootH1_10057976
150 rootH1_10105760
151 Ga0070658_10694752
152 Ga0070682_100290653
153 Ga0070682_100544242
154 Ga0070682_101437638
155 Ga0070668_100589369
156 Ga0070671_101053743
157 Ga0070673_101236698
158 Ga0070673_101628323
159 Ga0070667_100528995
160 Ga0070678_100607289
161 Ga0068853_100182223
162 Ga0070665_100159960
163 Ga0068855_100101910
164 Ga0068855_102385298
165 Ga0068857_101306520
166 Ga0068856_100039135
167 Ga0068866_10049840
168 Ga0068863_101157146
169 Ga0075366_10405452
170 Ga0075366_10507205
171 Ga0097621_100344781
172 Ga0097621_100402701
173 Ga0075370_10560420
174 Ga0068871_100525988
175 Ga0068871_100648922
176 Ga0068871_100878001
177 Ga0105240_10000276
178 Ga0105240_10094046
179 Ga0105240_10336145
180 Ga0105240_10679376
181 Ga0105240_11914662
182 Ga0105241_10007888
183 Ga0105241_10022149
184 Ga0105241_10164466
185 Ga0105242_13327076
186 Ga0105237_10030371
187 Ga0105237_10087852
188 Ga0105237_10238821
189 Ga0105237_11621092
190 Ga0105238_10002054
191 Ga0105239_10000263
192 Ga0105239_10035330
193 Ga0105239_10338182
194 Ga0105239_10556469
195 Ga0157370_10128249
196 Ga0157369_10961024
197 Ga0157374_12196663
198 Ga0157378_10999364
199 Ga0157378_11489140
200 Ga0157378_11531819
201 Ga0163162_10296484
202 Ga0157372_10003071
203 Ga0157372_10141420
204 Ga0157372_10332413
205 Ga0157375_10929223
206 Ga0163163_10521078
207 Ga0163163_12576818
208 Ga0157380_10211617
209 Ga0157377_11430436
210 Ga0157379_10973533
211 Ga0157379_11088286
212 Ga0157376_10715379
213 Ga0207647_10052863
214 Ga0207647_10195401
215 Ga0207647_10737238
216 Ga0207654_10030561
217 Ga0207654_10068658
218 Ga0207695_10000456
219 Ga0207695_10078335
220 Ga0207695_10373206
221 Ga0207671_10049791
222 Ga0207671_10701515
223 Ga0207694_10140174
224 Ga0207650_11859437
225 Ga0207667_10140168
226 Ga0207667_10164146
227 Ga0207651_10970089
228 Ga0207651_12038541
229 Ga0207668_10198324
230 Ga0207658_10714533
231 Ga0207639_10108065
232 Ga0207702_10037031
233 Ga0207641_11025216
234 Ga0207674_10038634
235 Ga0207683_10209771
236 Ga0268265_11052339
237 Ga0268264_10217590
238 Ga0307515_10000193
239 Ga0265327_10022787
240 Ga0307513_10312219
241 Ga0307507_10444767
242 Ga0373927_0088892
243 Ga0451793_1418332
244 Ga0451800_1598427
245 Ga0451802_0185839
246 Ga0451851_1188781
247 Ga0466969_0000102
248 Ga0466972_0000668
249 Ga0466966_0000018
250 Ga0466961_0038256
251 Ga0466961_0195251
252 Ga0466961_0635309
253 Ga0466964_0328566
254 Ga0466971_0038240
255 Ga0466968_0190417
256 Ga0466970_0254276
257 Ga0466959_0000002
258 Ga0466959_0032780
259 Ga0466958_0030466
260 Ga0495611_0021462
261 Ga0501198_005097
262 Ga0501222_008280
263 Ga0501233_083437
264 Ga0501242_001003
265 Ga0501225_0007023
266 Ga0501278_017449
267 nmdc:mga0k408_227926_c1
268 nmdc:mga0k408_410817_c1
269 Ga0500635_0000414
270 Ga0500578_0291724
271 Ga0500583_0001253
272 Ga0500642_0147148
273 Ga0500655_003463
274 Ga0500568_0003130
275 Ga0500577_0549580
276 Ga0500604_0004318
277 Ga0500622_0002806
278 Ga0500611_000005
279 Ga0590075_054165
280 Ga0466962_0052760
281 2929922948
282 8003152287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7983 3 119
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7744 3 119
3r4q-assembly3.cif.gz_E-2 crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.7712 4 119
3r4q-assembly2.cif.gz_D crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.7641 4 119
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.7638 3 119
ID Description Score Start End Superfamily
3r4qE01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.774 6 119 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7714 1 56 3.10.180.10
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7634 6 119 3.10.180.10
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7619 4 56 3.30.720.120
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7609 7 54 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A7Y4VL89-F1-model_v4 Glyoxalase 0.9831 1 62
AF-A0A385STZ5-F1-model_v4 VOC family protein 0.9828 1 120
AF-A0A5M6CPU2-F1-model_v4 VOC domain-containing protein 0.9784 1 120
AF-A0A2W6TFN0-F1-model_v4 Glyoxalase 0.9778 1 62
AF-A0A562SUG9-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9754 1 120

Map