F183050

General Info

Members Datasets Scaffolds Average Seq Length
141 103 282 314

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10002095|Ga0265338_1000209526
Length 361
Sequence MILLAFGYVDALYTLLGQACQSSPRGTCISGNRTSPAEASKNTTSWYILELTVLIETRDLTKVYGQLHAVSHLDIKLEPGDVFGFIGPNGSGKTTTMRMLATLLNPTWGEAYVCGYSIYTKPKEIRRLIGFMPDFFGVYDDMKVIEYLEFFAAAYRIKGTARRKKCEEVLDLVDLGYKREALVTSLSRGMTQRMGLARVLLHDPAVLLLDEPASGLDPRARIEIRGLLKELRKMGKTIMVSSHILPELADICNKIGIIERGELLVNSDVDEVMRRVRRQIVLKIGVVGDLQAAAKLLERQECVEKVSVADGVVTTTLLADRTDYSDLAGLLIGAGHKLTLFREEEVNLETAFMELTKGITA

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
35 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
53 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
59 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
60 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
63 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
64 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
65 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
80 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
81 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
82 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
83 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
84 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
85 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
86 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
87 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
88 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
89 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
90 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
91 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
92 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
93 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
94 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
95 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
96 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
97 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
98 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
99 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
100 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
101 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
102 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
103 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.78
Metatranscriptomes 0
Isolates 9.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.09
Nodule 0
Rhizoplane 5.67
Rhizosphere 80.85
Stem 0
Stem Tuber 0
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10002095 3300028800 Bacteria 30808
2 JGI25151J46595_10014325 3300003187 Bacteria 3536
3 JGI25151J46595_10072077 3300003187 Bacteria 1040
4 JGI25406J46586_10062216 3300003203 Bacteria 1200
5 Ga0055538_1000436 3300003751 Bacteria 16055
6 Ga0055536_1013196 3300003781 Bacteria 3002
7 Ga0065704_10136101 3300005289 Bacteria 1569
8 Ga0070690_100016219 3300005330 Bacteria 4458
9 Ga0070666_10011034 3300005335 Bacteria 5663
10 Ga0070680_100067508 3300005336 Unclassified 2933
11 Ga0070713_100284946 3300005436 Bacteria 1517
12 Ga0070700_100096222 3300005441 Bacteria 1942
13 Ga0070694_100392746 3300005444 Bacteria 1084
14 Ga0070707_100395627 3300005468 Bacteria 1342
15 Ga0070698_100444279 3300005471 Bacteria 1232
16 Ga0070699_100193739 3300005518 Bacteria 1806
17 Ga0068853_100008623 3300005539 Bacteria 8198
18 Ga0070665_100001784 3300005548 Bacteria 24519
19 Ga0070704_100106251 3300005549 Unclassified 2127
20 Ga0068855_100056447 3300005563 Bacteria 4608
21 Ga0081455_10132953 3300005937 Bacteria 1942
22 Ga0081539_10053199 3300005985 Bacteria 2268
23 Ga0075428_100001537 3300006844 Bacteria 24705
24 Ga0075428_100005838 3300006844 Bacteria 13676
25 Ga0075428_100082917 3300006844 Bacteria 3498
26 Ga0075428_100156907 3300006844 Bacteria 2471
27 Ga0075433_10111958 3300006852 Bacteria 2422
28 Ga0075433_10136285 3300006852 Bacteria 2182
29 Ga0075433_10431464 3300006852 Bacteria 1162
30 Ga0075434_100581809 3300006871 Bacteria 1139
31 Ga0075429_100065937 3300006880 Bacteria 3152
32 Ga0111539_10094484 3300009094 Bacteria 3513
33 Ga0114129_10054858 3300009147 Bacteria 5586
34 Ga0114129_10059799 3300009147 Bacteria 5328
35 Ga0114129_10132309 3300009147 Bacteria 3425
36 Ga0105242_10261530 3300009176 Bacteria 1563
37 Ga0105248_10132046 3300009177 Bacteria 2817
38 Ga0105237_10092542 3300009545 Bacteria 3013
39 Ga0105238_10001736 3300009551 Bacteria 21936
40 Ga0105239_10256862 3300010375 Bacteria 1963
41 Ga0157378_10234756 3300013297 Unclassified 1749
42 Ga0213873_10042848 3300021358 Bacteria 1172
43 Ga0209784_100277 3300025224 Bacteria 29291
44 Ga0209676_1001139 3300025292 Bacteria 29091
45 Ga0209676_1004467 3300025292 Bacteria 7772
46 Ga0209025_1002956 3300025294 Bacteria 16893
47 Ga0209025_1050494 3300025294 Bacteria 1662
48 Ga0207660_10255061 3300025917 Unclassified 1385
49 Ga0207694_10003701 3300025924 Bacteria 12108
50 Ga0207700_10271525 3300025928 Bacteria 1456
51 Ga0207664_10083396 3300025929 Bacteria 2605
52 Ga0207704_10003783 3300025938 Bacteria 6891
53 Ga0207639_10009026 3300026041 Bacteria 6867
54 Ga0268266_10004380 3300028379 Bacteria 13546
55 Ga0265338_10000351 3300028800 Bacteria 83671
56 Ga0265325_10000848 3300031241 Bacteria 22096
57 Ga0265339_10007393 3300031249 Bacteria 7107
58 Ga0265331_10000238 3300031250 Bacteria 66489
59 Ga0265327_10015172 3300031251 Bacteria 4991
60 Ga0265313_10001768 3300031595 Bacteria 19808
61 Ga0265314_10000128 3300031711 Bacteria 116273
62 Ga0265342_10004984 3300031712 Bacteria 10251
63 Ga0436364_1109575 3300037853 Bacteria 1073
64 Ga0436360_0109932 3300039438 Bacteria 1077
65 Ga0436360_0150507 3300039438 Bacteria 1322
66 Ga0436360_0454623 3300039438 Bacteria 7624
67 Ga0436361_0074659 3300039447 Bacteria 1156
68 Ga0436363_1115635 3300039450 Bacteria 1163
69 Ga0436362_0384361 3300039453 Bacteria 2271
70 Ga0436362_0555776 3300039453 Bacteria 1115
71 Ga0436362_0737819 3300039453 Bacteria 1148
72 Ga0453683_0200386 3300044673 Bacteria 1267
73 Ga0496104_0301571 3300048907 Bacteria 1514
74 Ga0496105_0130941 3300048908 Bacteria 2068
75 Ga0496108_0398409 3300048911 Bacteria 1202
76 Ga0496110_0217443 3300048913 Bacteria 1738
77 Ga0496112_0093092 3300048915 Bacteria 2984
78 Ga0496114_0189462 3300048917 Bacteria 1799
79 Ga0496115_0407830 3300048918 Bacteria 1102
80 Ga0496115_0421148 3300048918 Bacteria 1082
81 Ga0496126_0111295 3300048929 Bacteria 2385
82 Ga0501031_0240040 3300049568 Bacteria 1178
83 Ga0501033_0170569 3300049570 Bacteria 1563
84 Ga0501034_0002093 3300049571 Bacteria 24922
85 Ga0501034_0002873 3300049571 Bacteria 20025
86 Ga0501034_0004384 3300049571 Bacteria 15722
87 Ga0501034_0017935 3300049571 Bacteria 7260
88 Ga0501034_0203033 3300049571 Bacteria 1940
89 Ga0501036_0200595 3300049572 Bacteria 1678
90 Ga0501036_0347658 3300049572 Bacteria 1238
91 Ga0501039_0304046 3300049575 Bacteria 1254
92 Ga0501040_0171888 3300049576 Bacteria 1534
93 Ga0501041_0163497 3300049577 Bacteria 1392
94 Ga0501041_0185327 3300049577 Bacteria 1303
95 Ga0501042_0154729 3300049578 Bacteria 1654
96 Ga0501042_0216705 3300049578 Bacteria 1381
97 Ga0501043_0021351 3300049579 Bacteria 5075
98 Ga0501043_0134015 3300049579 Bacteria 1941
99 Ga0501046_0014395 3300049580 Bacteria 6677
100 Ga0501046_0015652 3300049580 Bacteria 6369
101 Ga0501046_0046872 3300049580 Bacteria 3429
102 Ga0501046_0127698 3300049580 Bacteria 1930
103 Ga0501047_0044042 3300049581 Bacteria 4310
104 Ga0501047_0087276 3300049581 Bacteria 2997
105 Ga0501047_0284842 3300049581 Bacteria 1496
106 Ga0501048_0056412 3300049582 Bacteria 2787
107 Ga0501070_0003301 3300049586 Bacteria 14004
108 Ga0501075_0237297 3300049591 Bacteria 1390
109 Ga0501077_0328710 3300049593 Bacteria 975
110 Ga0501044_0037193 3300049823 Bacteria 5089
111 Ga0501044_0378472 3300049823 Bacteria 1331
112 nmdc:mga05p37_1123_c1 3300050507 Bacteria 30743
113 nmdc:mga05p37_731825_c1 3300050507 Bacteria 1093
114 nmdc:mga09592_259291_c1 3300050508 Bacteria 1507
115 nmdc:mga08y16_119661_c1 3300050511 Bacteria 2741
116 nmdc:mga08y16_409764_c1 3300050511 Bacteria 1386
117 nmdc:mga0n895_69168_c1 3300050512 Bacteria 3497
118 nmdc:mga0a205_107489_c1 3300050515 Bacteria 2688
119 nmdc:mga0a205_158876_c1 3300050515 Bacteria 2158
120 nmdc:mga0a205_201919_c1 3300050515 Bacteria 1878
121 nmdc:mga0a205_70717_c1 3300050515 Bacteria 3369
122 Ga0495601_0000447 3300053077 Bacteria 21597
123 Ga0495619_0031751 3300053085 Bacteria 3424
124 Ga0495619_0041012 3300053085 Bacteria 3027
125 Ga0495619_0098985 3300053085 Bacteria 1983
126 Ga0500616_0000020 3300053153 Bacteria 530404
127 Ga0501084_0016099 3300054114 Bacteria 6209
128 Ga0501084_0463817 3300054114 Bacteria 1071
129 2688066294 2687453257 Bacteria 6784659
130 2688392582 2687453341 Bacteria 6534136
131 2791212098 2788500588 Bacteria 4584915
132 2808868359 2808606364 Bacteria 4465927
133 2819628078 2818991451 Bacteria 4697364
134 2836164289 2836160341 Unclassified 5867367
135 2852674837 2852673933 Bacteria 3347676
136 2889416707 2889415604 Bacteria 8048700
137 2904608397 2904606771 Bacteria 4684500
138 2920114643 2920107658 Bacteria 10042636
139 2928511529 2928510474 Bacteria 4815308
140 2939593835 2939593269 Bacteria 4798695
141 8055532778 8055531788 Bacteria 5249694
142 Ga0265338_10002095
143 JGI25151J46595_10014325
144 JGI25151J46595_10072077
145 JGI25406J46586_10062216
146 Ga0055538_1000436
147 Ga0055536_1013196
148 Ga0065704_10136101
149 Ga0070690_100016219
150 Ga0070666_10011034
151 Ga0070680_100067508
152 Ga0070713_100284946
153 Ga0070700_100096222
154 Ga0070694_100392746
155 Ga0070707_100395627
156 Ga0070698_100444279
157 Ga0070699_100193739
158 Ga0068853_100008623
159 Ga0070665_100001784
160 Ga0070704_100106251
161 Ga0068855_100056447
162 Ga0081455_10132953
163 Ga0081539_10053199
164 Ga0075428_100001537
165 Ga0075428_100005838
166 Ga0075428_100082917
167 Ga0075428_100156907
168 Ga0075433_10111958
169 Ga0075433_10136285
170 Ga0075433_10431464
171 Ga0075434_100581809
172 Ga0075429_100065937
173 Ga0111539_10094484
174 Ga0114129_10054858
175 Ga0114129_10059799
176 Ga0114129_10132309
177 Ga0105242_10261530
178 Ga0105248_10132046
179 Ga0105237_10092542
180 Ga0105238_10001736
181 Ga0105239_10256862
182 Ga0157378_10234756
183 Ga0213873_10042848
184 Ga0209784_100277
185 Ga0209676_1001139
186 Ga0209676_1004467
187 Ga0209025_1002956
188 Ga0209025_1050494
189 Ga0207660_10255061
190 Ga0207694_10003701
191 Ga0207700_10271525
192 Ga0207664_10083396
193 Ga0207704_10003783
194 Ga0207639_10009026
195 Ga0268266_10004380
196 Ga0265338_10000351
197 Ga0265325_10000848
198 Ga0265339_10007393
199 Ga0265331_10000238
200 Ga0265327_10015172
201 Ga0265313_10001768
202 Ga0265314_10000128
203 Ga0265342_10004984
204 Ga0436364_1109575
205 Ga0436360_0109932
206 Ga0436360_0150507
207 Ga0436360_0454623
208 Ga0436361_0074659
209 Ga0436363_1115635
210 Ga0436362_0384361
211 Ga0436362_0555776
212 Ga0436362_0737819
213 Ga0453683_0200386
214 Ga0496104_0301571
215 Ga0496105_0130941
216 Ga0496108_0398409
217 Ga0496110_0217443
218 Ga0496112_0093092
219 Ga0496114_0189462
220 Ga0496115_0407830
221 Ga0496115_0421148
222 Ga0496126_0111295
223 Ga0501031_0240040
224 Ga0501033_0170569
225 Ga0501034_0002093
226 Ga0501034_0002873
227 Ga0501034_0004384
228 Ga0501034_0017935
229 Ga0501034_0203033
230 Ga0501036_0200595
231 Ga0501036_0347658
232 Ga0501039_0304046
233 Ga0501040_0171888
234 Ga0501041_0163497
235 Ga0501041_0185327
236 Ga0501042_0154729
237 Ga0501042_0216705
238 Ga0501043_0021351
239 Ga0501043_0134015
240 Ga0501046_0014395
241 Ga0501046_0015652
242 Ga0501046_0046872
243 Ga0501046_0127698
244 Ga0501047_0044042
245 Ga0501047_0087276
246 Ga0501047_0284842
247 Ga0501048_0056412
248 Ga0501070_0003301
249 Ga0501075_0237297
250 Ga0501077_0328710
251 Ga0501044_0037193
252 Ga0501044_0378472
253 nmdc:mga05p37_1123_c1
254 nmdc:mga05p37_731825_c1
255 nmdc:mga09592_259291_c1
256 nmdc:mga08y16_119661_c1
257 nmdc:mga08y16_409764_c1
258 nmdc:mga0n895_69168_c1
259 nmdc:mga0a205_107489_c1
260 nmdc:mga0a205_158876_c1
261 nmdc:mga0a205_201919_c1
262 nmdc:mga0a205_70717_c1
263 Ga0495601_0000447
264 Ga0495619_0031751
265 Ga0495619_0041012
266 Ga0495619_0098985
267 Ga0500616_0000020
268 Ga0501084_0016099
269 Ga0501084_0463817
270 2688066294
271 2688392582
272 2791212098
273 2808868359
274 2819628078
275 2836164289
276 2852674837
277 2889416707
278 2904608397
279 2920114643
280 2928511529
281 2939593835
282 8055532778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

70

214

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

114

250

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9488 2 216
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9439 2 224
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9337 2 219
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9315 1 215
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9299 1 219
ID Description Score Start End Superfamily
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9608 1 222 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9572 2 222 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9572 2 222 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9556 2 222 3.40.50.300
af_Q8T5Z7_540_794_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9542 2 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9756 2 181 GO:0005524
GO:0016887
AF-A0A662BGZ5-F1-model_v4 Gliding motility-associated ABC transporter ATP-binding subunit GldA 0.9742 2 191 GO:0005524
GO:0016887
AF-A0A3R8R1F7-F1-model_v4 deleted 0.9649 1 97
AF-A0A7C3UTB1-F1-model_v4 ABC transporter ATP-binding protein 0.9617 2 215 GO:0005524
GO:0016887
AF-A0A7X8M6Z4-F1-model_v4 ABC transporter ATP-binding protein 0.9605 2 174 GO:0005524
GO:0016887

Map