F182554

General Info

Members Datasets Scaffolds Average Seq Length
141 116 282 263

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10495634|Ga0105239_104956341
Length 274
Sequence MTTAAPSSAPTSDLTGWRCAPFTGAGQTYDCYEKGEGPGVVLVPEIPGITPEVLGLADHLVTEGFTVVIPSPFGTPGKPMTGGYVAKTFARVCIAKEFRAFATNAHRPIADFLKVLAANLARRTPGRGVGVIGMCFTGGFALAAAVEPSVLAPVMSQPSTPMPVSKSRRHDPCVSAEELDAVAARTADGLCVMGLRFTKDRAVPDERIAALRARLGDAFEVIELDSSPGNPGGFKKTAHSVLTHEVREQPGQQAFLARARVVQFLRERLAPASD

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
44 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
45 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
46 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
47 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
48 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
57 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
58 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
59 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
60 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
61 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
62 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
63 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
64 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
65 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
66 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
67 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
68 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
69 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
70 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
71 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
72 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
73 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
74 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
75 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
76 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
77 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
78 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
79 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
80 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
100 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
101 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 2558860280 Kutzneria sp. 744 Isolate Unclassified
104 2643221572 Leifsonia sp. Root60 Isolate Unclassified
105 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
106 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
107 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
108 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
109 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
110 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
111 2862574272 Streptomyces sp. AcE210 Isolate Nodule
112 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
113 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
114 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
115 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
116 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.07
Metatranscriptomes 0
Isolates 9.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.8
Nodule 0.71
Rhizoplane 12.06
Rhizosphere 63.12
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10495634 3300010375 Bacteria 1389
2 JGI24740J21852_10060317 3300001979 Bacteria 1048
3 JGI24739J22299_10024690 3300001989 Bacteria 2117
4 JGI24737J22298_10001370 3300001990 Bacteria 8643
5 rootL2_10050902 3300003322 Bacteria 2383
6 Ga0070668_100042001 3300005347 Bacteria 3504
7 Ga0070663_100556479 3300005455 Bacteria 959
8 Ga0070681_10480507 3300005458 Bacteria 1155
9 Ga0068853_100003635 3300005539 Bacteria 11826
10 Ga0068855_100373477 3300005563 Bacteria 1567
11 Ga0068857_100057580 3300005577 Bacteria 3449
12 Ga0068857_100256912 3300005577 Bacteria 1603
13 Ga0068862_100343368 3300005844 Unclassified 1383
14 Ga0081455_10104439 3300005937 Bacteria 2267
15 Ga0081540_1004623 3300005983 Bacteria 10414
16 Ga0075365_10320139 3300006038 Bacteria 1092
17 Ga0105240_10911437 3300009093 Bacteria 945
18 Ga0105247_10003513 3300009101 Bacteria 10203
19 Ga0105248_10002282 3300009177 Bacteria 21224
20 Ga0105237_10137979 3300009545 Bacteria 2433
21 Ga0105239_10065553 3300010375 Bacteria 3989
22 Ga0105246_10220865 3300011119 Bacteria 1485
23 Ga0157378_10380430 3300013297 Bacteria 1386
24 Ga0163162_10099629 3300013306 Bacteria 2997
25 Ga0157372_10128616 3300013307 Bacteria 2913
26 Ga0157375_10731710 3300013308 Bacteria 1141
27 Ga0163163_10038533 3300014325 Bacteria 4660
28 Ga0157379_10002030 3300014968 Bacteria 16790
29 Ga0207710_10001843 3300025900 Bacteria 10215
30 Ga0207647_10006511 3300025904 Bacteria 8489
31 Ga0207671_10194499 3300025914 Bacteria 1582
32 Ga0207711_10006728 3300025941 Bacteria 9671
33 Ga0207668_10264594 3300025972 Bacteria 1403
34 Ga0207639_10022766 3300026041 Bacteria 4516
35 Ga0207674_10049590 3300026116 Bacteria 4293
36 Ga0207683_10505739 3300026121 Bacteria 1116
37 Ga0207698_10140544 3300026142 Bacteria 2079
38 Ga0268264_10208593 3300028381 Bacteria 1792
39 Ga0307517_10103645 3300028786 Unclassified 2222
40 Ga0307515_10438941 3300028794 Bacteria 923
41 Ga0307511_10000041 3300030521 Bacteria 102249
42 Ga0307513_10010665 3300031456 Bacteria 11497
43 Ga0307508_10135100 3300031616 Bacteria 2069
44 Ga0307516_10028508 3300031730 Bacteria 5649
45 Ga0307407_10185553 3300031903 Bacteria 1382
46 Ga0373925_0024961 3300037068 Bacteria 4365
47 Ga0439436_0057763 3300041404 Bacteria 1088
48 Ga0439438_005691 3300041405 Bacteria 4542
49 Ga0451797_0804503 3300041453 Bacteria 1193
50 Ga0451797_1243067 3300041453 Bacteria 1099
51 Ga0451853_3720999 3300041512 Bacteria 1064
52 Ga0439449_0019742 3300042007 Bacteria 2526
53 Ga0466969_0002741 3300044656 Bacteria 9423
54 Ga0466969_0010646 3300044656 Bacteria 4874
55 Ga0466966_0006001 3300044684 Bacteria 8019
56 Ga0466966_0106452 3300044684 Bacteria 1731
57 Ga0466961_0021871 3300044693 Bacteria 4114
58 Ga0466970_0062828 3300044765 Bacteria 1991
59 Ga0466959_0055111 3300045049 Bacteria 2903
60 Ga0466967_0124676 3300045976 Bacteria 2385
61 Ga0466967_0139611 3300045976 Bacteria 2256
62 Ga0466967_0945521 3300045976 Bacteria 857
63 Ga0495603_0009611 3300046455 Bacteria 5848
64 Ga0495585_0067265 3300046492 Bacteria 1960
65 Ga0495607_0040102 3300046501 Bacteria 2791
66 Ga0495631_0064711 3300046518 Bacteria 1583
67 Ga0496100_0023132 3300048903 Bacteria 3770
68 Ga0496102_0078006 3300048905 Bacteria 3049
69 Ga0496103_0005490 3300048906 Bacteria 7583
70 Ga0496104_0127782 3300048907 Bacteria 2440
71 Ga0496106_0142334 3300048909 Bacteria 1887
72 Ga0496107_0149010 3300048910 Bacteria 1730
73 Ga0496108_0080638 3300048911 Bacteria 2757
74 Ga0496109_0054697 3300048912 Bacteria 3640
75 Ga0496110_0236671 3300048913 Bacteria 1661
76 Ga0496111_0023318 3300048914 Bacteria 4344
77 Ga0496112_0067721 3300048915 Bacteria 3524
78 Ga0496113_0024971 3300048916 Bacteria 4255
79 Ga0496114_0056841 3300048917 Bacteria 3266
80 Ga0496114_0073646 3300048917 Bacteria 2874
81 Ga0496115_0086632 3300048918 Bacteria 2555
82 Ga0496119_0025563 3300048922 Bacteria 4119
83 Ga0496119_0071325 3300048922 Bacteria 2034
84 Ga0496120_0001007 3300048923 Bacteria 37893
85 Ga0496122_0004587 3300048925 Bacteria 17009
86 Ga0496122_0034545 3300048925 Bacteria 4136
87 Ga0496123_0005684 3300048926 Bacteria 12443
88 Ga0496124_0052549 3300048927 Bacteria 3461
89 Ga0496125_0239980 3300048928 Bacteria 1152
90 Ga0496126_0002705 3300048929 Bacteria 23429
91 Ga0501031_0004896 3300049568 Bacteria 8703
92 Ga0501032_0144921 3300049569 Bacteria 1563
93 Ga0501032_0231519 3300049569 Bacteria 1201
94 Ga0501033_0025049 3300049570 Bacteria 4495
95 Ga0501034_0073874 3300049571 Bacteria 3418
96 Ga0501036_0002284 3300049572 Bacteria 14991
97 Ga0501037_0006455 3300049573 Bacteria 8577
98 Ga0501037_0008375 3300049573 Bacteria 7581
99 Ga0501038_0000728 3300049574 Bacteria 29397
100 Ga0501038_0057843 3300049574 Bacteria 3327
101 Ga0501039_0069955 3300049575 Bacteria 2726
102 Ga0501042_0011346 3300049578 Bacteria 6010
103 Ga0501043_0000515 3300049579 Bacteria 34803
104 Ga0501043_0021857 3300049579 Bacteria 5016
105 Ga0501046_0003079 3300049580 Bacteria 15400
106 Ga0501047_0032730 3300049581 Bacteria 5019
107 Ga0501047_0089908 3300049581 Bacteria 2947
108 Ga0501048_0000069 3300049582 Bacteria 52868
109 Ga0501048_0007271 3300049582 Bacteria 8398
110 Ga0501068_0182152 3300049584 Bacteria 1328
111 Ga0501070_0006032 3300049586 Bacteria 10321
112 Ga0501074_0029762 3300049590 Bacteria 3956
113 Ga0501044_0008828 3300049823 Bacteria 11026
114 Ga0501044_0052147 3300049823 Bacteria 4216
115 Ga0501045_0019968 3300049824 Bacteria 4782
116 Ga0501045_0361476 3300049824 Bacteria 1080
117 Ga0500559_0000469 3300053136 Bacteria 28736
118 Ga0500559_0035523 3300053136 Bacteria 2153
119 Ga0500559_0085391 3300053136 Bacteria 1439
120 Ga0500559_0104590 3300053136 Bacteria 1307
121 Ga0500559_0150313 3300053136 Bacteria 1093
122 Ga0500573_0002029 3300053140 Bacteria 9932
123 Ga0500573_0016673 3300053140 Bacteria 4173
124 Ga0500573_0243041 3300053140 Bacteria 932
125 Ga0500616_0000107 3300053153 Bacteria 153426
126 Ga0500616_0000854 3300053153 Bacteria 33835
127 Ga0501082_0447028 3300060353 Bacteria 1129
128 2559432765 2558860280 Bacteria 11429938
129 2643876855 2643221572 Bacteria 3614809
130 2644383910 2643221669 Bacteria 3611286
131 2644456084 2643221681 Bacteria 3707866
132 2729905112 2728369276 Bacteria 5610032
133 2753267797 2751185782 Bacteria 11227053
134 2844853515 2844852863 Bacteria 3849151
135 2857731840 2857729791 Bacteria 4040535
136 2862575127 2862574272 Bacteria 10567477
137 2895663082 2895660088 Bacteria 3782833
138 3006489232 3006486233 Bacteria 8157040
139 8047714607 8047710418 Bacteria 11023148
140 8056040319 8056037122 Bacteria 3854319
141 8057347216 8057345674 Bacteria 4160394
142 Ga0105239_10495634
143 JGI24740J21852_10060317
144 JGI24739J22299_10024690
145 JGI24737J22298_10001370
146 rootL2_10050902
147 Ga0070668_100042001
148 Ga0070663_100556479
149 Ga0070681_10480507
150 Ga0068853_100003635
151 Ga0068855_100373477
152 Ga0068857_100057580
153 Ga0068857_100256912
154 Ga0068862_100343368
155 Ga0081455_10104439
156 Ga0081540_1004623
157 Ga0075365_10320139
158 Ga0105240_10911437
159 Ga0105247_10003513
160 Ga0105248_10002282
161 Ga0105237_10137979
162 Ga0105239_10065553
163 Ga0105246_10220865
164 Ga0157378_10380430
165 Ga0163162_10099629
166 Ga0157372_10128616
167 Ga0157375_10731710
168 Ga0163163_10038533
169 Ga0157379_10002030
170 Ga0207710_10001843
171 Ga0207647_10006511
172 Ga0207671_10194499
173 Ga0207711_10006728
174 Ga0207668_10264594
175 Ga0207639_10022766
176 Ga0207674_10049590
177 Ga0207683_10505739
178 Ga0207698_10140544
179 Ga0268264_10208593
180 Ga0307517_10103645
181 Ga0307515_10438941
182 Ga0307511_10000041
183 Ga0307513_10010665
184 Ga0307508_10135100
185 Ga0307516_10028508
186 Ga0307407_10185553
187 Ga0373925_0024961
188 Ga0439436_0057763
189 Ga0439438_005691
190 Ga0451797_0804503
191 Ga0451797_1243067
192 Ga0451853_3720999
193 Ga0439449_0019742
194 Ga0466969_0002741
195 Ga0466969_0010646
196 Ga0466966_0006001
197 Ga0466966_0106452
198 Ga0466961_0021871
199 Ga0466970_0062828
200 Ga0466959_0055111
201 Ga0466967_0124676
202 Ga0466967_0139611
203 Ga0466967_0945521
204 Ga0495603_0009611
205 Ga0495585_0067265
206 Ga0495607_0040102
207 Ga0495631_0064711
208 Ga0496100_0023132
209 Ga0496102_0078006
210 Ga0496103_0005490
211 Ga0496104_0127782
212 Ga0496106_0142334
213 Ga0496107_0149010
214 Ga0496108_0080638
215 Ga0496109_0054697
216 Ga0496110_0236671
217 Ga0496111_0023318
218 Ga0496112_0067721
219 Ga0496113_0024971
220 Ga0496114_0056841
221 Ga0496114_0073646
222 Ga0496115_0086632
223 Ga0496119_0025563
224 Ga0496119_0071325
225 Ga0496120_0001007
226 Ga0496122_0004587
227 Ga0496122_0034545
228 Ga0496123_0005684
229 Ga0496124_0052549
230 Ga0496125_0239980
231 Ga0496126_0002705
232 Ga0501031_0004896
233 Ga0501032_0144921
234 Ga0501032_0231519
235 Ga0501033_0025049
236 Ga0501034_0073874
237 Ga0501036_0002284
238 Ga0501037_0006455
239 Ga0501037_0008375
240 Ga0501038_0000728
241 Ga0501038_0057843
242 Ga0501039_0069955
243 Ga0501042_0011346
244 Ga0501043_0000515
245 Ga0501043_0021857
246 Ga0501046_0003079
247 Ga0501047_0032730
248 Ga0501047_0089908
249 Ga0501048_0000069
250 Ga0501048_0007271
251 Ga0501068_0182152
252 Ga0501070_0006032
253 Ga0501074_0029762
254 Ga0501044_0008828
255 Ga0501044_0052147
256 Ga0501045_0019968
257 Ga0501045_0361476
258 Ga0500559_0000469
259 Ga0500559_0035523
260 Ga0500559_0085391
261 Ga0500559_0104590
262 Ga0500559_0150313
263 Ga0500573_0002029
264 Ga0500573_0016673
265 Ga0500573_0243041
266 Ga0500616_0000107
267 Ga0500616_0000854
268 Ga0501082_0447028
269 2559432765
270 2643876855
271 2644383910
272 2644456084
273 2729905112
274 2753267797
275 2844853515
276 2857731840
277 2862575127
278 2895663082
279 3006489232
280 8047714607
281 8056040319
282 8057347216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

27

268

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6unw-assembly1.cif.gz_A epoxide hydrolase from an endophytic streptomyces 0.7655 8 147
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.7534 12 262
2qjw-assembly2.cif.gz_C crystal structure of a putative hydrolase of the alpha/beta superfamily (xcc1541) from xanthomonas campestris pv. campestris at 1.35 a resolution 0.7502 27 217
2e3j-assembly1.cif.gz_A the crystal structure of epoxide hydrolase b (rv1938) from mycobacterium tuberculosis at 2.1 angstrom 0.7477 9 147
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.7465 8 261
ID Description Score Start End Superfamily
af_I1K6A2_1_89_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7915 182 218 3.40.50.1820
2qjwD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7734 28 217 3.40.50.1820
af_Q0DGS8_1_242_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7511 168 216 3.40.50.1820
4ao6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7487 8 262 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7247 1 262 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A371XMC8-F1-model_v4 Dienelactone hydrolase 0.988 2 265 GO:0016787
AF-A0A1X1TSS4-F1-model_v4 Dienelactone hydrolase 0.9863 2 262 GO:0016787
AF-A0A2S9FZA2-F1-model_v4 Dienelactone hydrolase 0.9863 127 211 GO:0016787
AF-A0A5P2CNJ5-F1-model_v4 Dienelactone hydrolase 0.9862 2 265 GO:0016787
AF-X8FJV3-F1-model_v4 deleted 0.985 121 261

Map