F182035

General Info

Members Datasets Scaffolds Average Seq Length
141 100 282 398

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100058980|Ga0070704_1000589802
Length 416
Sequence MSANVGLAIQCVGVVLLTFLSVSMRSSNRSASLTCWTRAWACLSIALISLFIGFHVSTGHKLFYAIYFFGEYAFGLLFIAGCRSMVNGIEVTSRYYLLLIPAAVFAIILSFLSADFNDLFIVQALIVAALFIASGLALWPAFRRDQTSLGLRVMLLALWLLAIDFLHDVPVFGARKGLWGLTVPTSYLQYTSIFDLILEILLGFGTILVLSESVRREVEATNRQLTMTRDKLELMASMDPLTEALNRHAFHSLVNRDCSNDEPDSHGCVAVIDIDNLKLINDQYGHGVGDKAIRAVARAVRSLIRADDMVFRWGGDEFMVLLFKLPEEEASRRMGSLNSILQENGRQWTGCPVTISVSAGVSGFTSLSELGDAIERADQAMYDSRQQTRQSTSYRRRRPTAMAPAGLTIQDASLSM

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
81 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
84 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
85 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
86 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
87 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
88 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
89 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
90 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
91 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
92 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
93 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
94 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
95 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
96 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.29
Stem 0
Stem Tuber 0
Unclassified 14.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100058980 3300005549 Bacteria 2736
2 LJQas_1000171 3300000549 Bacteria 11553
3 JGI25406J46586_10016376 3300003203 Bacteria 3092
4 JGI25406J46586_10027678 3300003203 Bacteria 2170
5 Ga0065704_10081031 3300005289 Bacteria 3833
6 Ga0070690_100062414 3300005330 Unclassified 2403
7 Ga0068869_100044898 3300005334 Bacteria 3179
8 Ga0070689_100001007 3300005340 Bacteria 17652
9 Ga0070675_100026677 3300005354 Unclassified 4636
10 Ga0070671_100013754 3300005355 Bacteria 6529
11 Ga0070705_100092195 3300005440 Bacteria 1890
12 Ga0070694_100011013 3300005444 Bacteria 5594
13 Ga0070694_100023758 3300005444 Unclassified 3948
14 Ga0070694_100144926 3300005444 Bacteria 1729
15 Ga0070708_100179197 3300005445 Unclassified 1980
16 Ga0070708_100190913 3300005445 Bacteria 1916
17 Ga0070663_100137552 3300005455 Bacteria 1861
18 Ga0070681_10060954 3300005458 Bacteria 3749
19 Ga0070706_100003255 3300005467 Bacteria 16057
20 Ga0070707_100000694 3300005468 Bacteria 33438
21 Ga0070698_100000374 3300005471 Bacteria 46633
22 Ga0070698_100084824 3300005471 Unclassified 3155
23 Ga0070699_100018455 3300005518 Bacteria 5992
24 Ga0068853_100064169 3300005539 Bacteria 3183
25 Ga0068853_100270260 3300005539 Bacteria 1565
26 Ga0070672_100026106 3300005543 Bacteria 4341
27 Ga0070672_100040265 3300005543 Bacteria 3584
28 Ga0070686_100078280 3300005544 Unclassified 2183
29 Ga0070693_100020209 3300005547 Bacteria 3507
30 Ga0070693_100049845 3300005547 Bacteria 2391
31 Ga0070704_100000993 3300005549 Bacteria 14462
32 Ga0070704_100056558 3300005549 Bacteria 2786
33 Ga0070704_100162787 3300005549 Bacteria 1766
34 Ga0068859_100013796 3300005617 Bacteria 8101
35 Ga0068859_100072188 3300005617 Bacteria 3488
36 Ga0068859_100079451 3300005617 Bacteria 3320
37 Ga0068859_100274309 3300005617 Bacteria 1779
38 Ga0068859_100398658 3300005617 Bacteria 1472
39 Ga0068864_100000825 3300005618 Bacteria 26108
40 Ga0068864_100149516 3300005618 Unclassified 2114
41 Ga0068866_10012600 3300005718 Unclassified 3688
42 Ga0068861_100060886 3300005719 Unclassified 2895
43 Ga0068870_10048704 3300005840 Bacteria 2232
44 Ga0068863_100018091 3300005841 Bacteria 6748
45 Ga0068863_100108853 3300005841 Bacteria 2637
46 Ga0068858_100055924 3300005842 Bacteria 3647
47 Ga0068860_100052873 3300005843 Bacteria 3863
48 Ga0068860_100152464 3300005843 Unclassified 2226
49 Ga0068862_100004590 3300005844 Bacteria 11636
50 Ga0081539_10000998 3300005985 Bacteria 52505
51 Ga0081539_10034935 3300005985 Bacteria 3030
52 Ga0075430_100164506 3300006846 Bacteria 1846
53 Ga0075433_10039854 3300006852 Bacteria 4063
54 Ga0075434_100118824 3300006871 Bacteria 2657
55 Ga0075436_100028659 3300006914 Bacteria 3830
56 Ga0097620_100013796 3300006931 Bacteria 8101
57 Ga0097620_100072196 3300006931 Bacteria 3488
58 Ga0097620_100079447 3300006931 Bacteria 3320
59 Ga0097620_100274291 3300006931 Bacteria 1779
60 Ga0097620_100398679 3300006931 Bacteria 1472
61 Ga0097620_100450795 3300006931 Bacteria 1383
62 Ga0114129_10006447 3300009147 Bacteria 16640
63 Ga0114129_10061845 3300009147 Bacteria 5233
64 Ga0105241_10025400 3300009174 Bacteria 4402
65 Ga0105248_10047232 3300009177 Bacteria 4828
66 Ga0105248_10141741 3300009177 Unclassified 2712
67 Ga0105248_10162145 3300009177 Bacteria 2521
68 Ga0105248_10376598 3300009177 Bacteria 1598
69 Ga0105249_10031153 3300009553 Bacteria 4822
70 Ga0105249_10041657 3300009553 Bacteria 4175
71 Ga0157373_10031402 3300013100 Bacteria 3824
72 Ga0157378_10025284 3300013297 Bacteria 5229
73 Ga0157378_10176840 3300013297 Unclassified 2005
74 Ga0157375_10361827 3300013308 Bacteria 1617
75 Ga0163163_10028658 3300014325 Bacteria 5351
76 Ga0163163_10092586 3300014325 Bacteria 3038
77 Ga0163163_10432387 3300014325 Bacteria 1375
78 Ga0157380_10014407 3300014326 Bacteria 5783
79 Ga0157380_10025496 3300014326 Bacteria 4484
80 Ga0157380_10267550 3300014326 Bacteria 1556
81 Ga0157377_10052316 3300014745 Bacteria 2305
82 Ga0163161_10056584 3300017792 Bacteria 2848
83 Ga0207643_10001186 3300025908 Bacteria 15432
84 Ga0207684_10000316 3300025910 Bacteria 68606
85 Ga0207654_10112080 3300025911 Bacteria 1699
86 Ga0207695_10004547 3300025913 Bacteria 18870
87 Ga0207646_10002426 3300025922 Bacteria 22003
88 Ga0207681_10056293 3300025923 Bacteria 2682
89 Ga0207650_10023404 3300025925 Bacteria 4380
90 Ga0207650_10134484 3300025925 Unclassified 1938
91 Ga0207659_10240071 3300025926 Bacteria 1465
92 Ga0207670_10000411 3300025936 Bacteria 24367
93 Ga0207669_10017154 3300025937 Bacteria 3705
94 Ga0207704_10142092 3300025938 Bacteria 1681
95 Ga0207691_10018410 3300025940 Bacteria 6619
96 Ga0207711_10371860 3300025941 Unclassified 1325
97 Ga0207689_10083075 3300025942 Bacteria 2633
98 Ga0207651_10111297 3300025960 Bacteria 2056
99 Ga0207668_10198957 3300025972 Bacteria 1594
100 Ga0207703_10025587 3300026035 Bacteria 4642
101 Ga0207639_10000020 3300026041 Bacteria 236698
102 Ga0207678_10161398 3300026067 Bacteria 1914
103 Ga0207641_10188955 3300026088 Bacteria 1892
104 Ga0207676_10003355 3300026095 Bacteria 11348
105 Ga0268265_10144713 3300028380 Unclassified 1995
106 Ga0268264_10052898 3300028381 Bacteria 3387
107 Ga0307408_100114248 3300031548 Bacteria 2080
108 Ga0307409_100323319 3300031995 Bacteria 1445
109 Ga0307416_100133017 3300032002 Bacteria 2243
110 Ga0307414_10109503 3300032004 Bacteria 2099
111 Ga0307414_10260047 3300032004 Unclassified 1448
112 Ga0373951_0000784 3300035091 Bacteria 8661
113 Ga0395900_0253843 3300037418 Bacteria 1759
114 Ga0395898_0267901 3300037466 Bacteria 1629
115 Ga0436360_1247201 3300039438 Unclassified 2058
116 Ga0451837_1751674 3300041494 Bacteria 6481
117 Ga0439458_0000585 3300042157 Bacteria 9389
118 Ga0451576_0484894 3300045051 Unclassified 1299
119 Ga0495598_0008925 3300046537 Bacteria 2350
120 Ga0501295_001267 3300049518 Bacteria 2544
121 Ga0501298_004568 3300049521 Bacteria 2188
122 Ga0501298_012607 3300049521 Bacteria 1485
123 Ga0501299_002193 3300049522 Bacteria 2677
124 Ga0501299_005104 3300049522 Bacteria 2001
125 Ga0501299_009374 3300049522 Bacteria 1612
126 Ga0501072_0003094 3300049588 Bacteria 12541
127 Ga0501202_017786 3300049652 Unclassified 1391
128 Ga0501223_008761 3300049663 Bacteria 2060
129 Ga0501233_002740 3300049668 Bacteria 3124
130 Ga0501235_016384 3300049669 Bacteria 1637
131 Ga0501243_005278 3300049675 Bacteria 1942
132 Ga0501249_011023 3300049679 Bacteria 1894
133 Ga0501250_002284 3300049680 Bacteria 1719
134 Ga0501260_001150 3300049689 Bacteria 2141
135 Ga0501225_0005586 3300049705 Bacteria 3686
136 nmdc:mga05p37_24798_c1 3300050507 Bacteria 7290
137 nmdc:mga0n895_160578_c1 3300050512 Bacteria 2279
138 nmdc:mga08x19_9058_c1 3300050514 Bacteria 5942
139 nmdc:mga0a205_15335_c1 3300050515 Bacteria 7160
140 nmdc:mga0a205_162654_c1 3300050515 Bacteria 2128
141 nmdc:mga0a205_64086_c1 3300050515 Unclassified 3550
142 Ga0070704_100058980
143 LJQas_1000171
144 JGI25406J46586_10016376
145 JGI25406J46586_10027678
146 Ga0065704_10081031
147 Ga0070690_100062414
148 Ga0068869_100044898
149 Ga0070689_100001007
150 Ga0070675_100026677
151 Ga0070671_100013754
152 Ga0070705_100092195
153 Ga0070694_100011013
154 Ga0070694_100023758
155 Ga0070694_100144926
156 Ga0070708_100179197
157 Ga0070708_100190913
158 Ga0070663_100137552
159 Ga0070681_10060954
160 Ga0070706_100003255
161 Ga0070707_100000694
162 Ga0070698_100000374
163 Ga0070698_100084824
164 Ga0070699_100018455
165 Ga0068853_100064169
166 Ga0068853_100270260
167 Ga0070672_100026106
168 Ga0070672_100040265
169 Ga0070686_100078280
170 Ga0070693_100020209
171 Ga0070693_100049845
172 Ga0070704_100000993
173 Ga0070704_100056558
174 Ga0070704_100162787
175 Ga0068859_100013796
176 Ga0068859_100072188
177 Ga0068859_100079451
178 Ga0068859_100274309
179 Ga0068859_100398658
180 Ga0068864_100000825
181 Ga0068864_100149516
182 Ga0068866_10012600
183 Ga0068861_100060886
184 Ga0068870_10048704
185 Ga0068863_100018091
186 Ga0068863_100108853
187 Ga0068858_100055924
188 Ga0068860_100052873
189 Ga0068860_100152464
190 Ga0068862_100004590
191 Ga0081539_10000998
192 Ga0081539_10034935
193 Ga0075430_100164506
194 Ga0075433_10039854
195 Ga0075434_100118824
196 Ga0075436_100028659
197 Ga0097620_100013796
198 Ga0097620_100072196
199 Ga0097620_100079447
200 Ga0097620_100274291
201 Ga0097620_100398679
202 Ga0097620_100450795
203 Ga0114129_10006447
204 Ga0114129_10061845
205 Ga0105241_10025400
206 Ga0105248_10047232
207 Ga0105248_10141741
208 Ga0105248_10162145
209 Ga0105248_10376598
210 Ga0105249_10031153
211 Ga0105249_10041657
212 Ga0157373_10031402
213 Ga0157378_10025284
214 Ga0157378_10176840
215 Ga0157375_10361827
216 Ga0163163_10028658
217 Ga0163163_10092586
218 Ga0163163_10432387
219 Ga0157380_10014407
220 Ga0157380_10025496
221 Ga0157380_10267550
222 Ga0157377_10052316
223 Ga0163161_10056584
224 Ga0207643_10001186
225 Ga0207684_10000316
226 Ga0207654_10112080
227 Ga0207695_10004547
228 Ga0207646_10002426
229 Ga0207681_10056293
230 Ga0207650_10023404
231 Ga0207650_10134484
232 Ga0207659_10240071
233 Ga0207670_10000411
234 Ga0207669_10017154
235 Ga0207704_10142092
236 Ga0207691_10018410
237 Ga0207711_10371860
238 Ga0207689_10083075
239 Ga0207651_10111297
240 Ga0207668_10198957
241 Ga0207703_10025587
242 Ga0207639_10000020
243 Ga0207678_10161398
244 Ga0207641_10188955
245 Ga0207676_10003355
246 Ga0268265_10144713
247 Ga0268264_10052898
248 Ga0307408_100114248
249 Ga0307409_100323319
250 Ga0307416_100133017
251 Ga0307414_10109503
252 Ga0307414_10260047
253 Ga0373951_0000784
254 Ga0395900_0253843
255 Ga0395898_0267901
256 Ga0436360_1247201
257 Ga0451837_1751674
258 Ga0439458_0000585
259 Ga0451576_0484894
260 Ga0495598_0008925
261 Ga0501295_001267
262 Ga0501298_004568
263 Ga0501298_012607
264 Ga0501299_002193
265 Ga0501299_005104
266 Ga0501299_009374
267 Ga0501072_0003094
268 Ga0501202_017786
269 Ga0501223_008761
270 Ga0501233_002740
271 Ga0501235_016384
272 Ga0501243_005278
273 Ga0501249_011023
274 Ga0501250_002284
275 Ga0501260_001150
276 Ga0501225_0005586
277 nmdc:mga05p37_24798_c1
278 nmdc:mga0n895_160578_c1
279 nmdc:mga08x19_9058_c1
280 nmdc:mga0a205_15335_c1
281 nmdc:mga0a205_162654_c1
282 nmdc:mga0a205_64086_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00990

GGDEF

Diguanylate cyclase, GGDEF domain

236

391

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5euh-assembly2.cif.gz_B crystal structure of the c-di-gmp-bound ggdef domain of p. fluorescens gcbc 0.8171 246 386
4wxw-assembly1.cif.gz_A sadc (323-487) from pseudomonas aeruginosa pao1 0.8153 242 386
6tts-assembly1.cif.gz_A crystal structure of the ggdef domain of dgcb from caulobacter crescentus in complex with c-di-gmp 0.8144 246 386
4zve-assembly1.cif.gz_A crystal structure of ggdef domain of the e. coli dosc - form i (apo-form) 0.8109 245 386
6tts-assembly1.cif.gz_B crystal structure of the ggdef domain of dgcb from caulobacter crescentus in complex with c-di-gmp 0.8075 246 387
ID Description Score Start End Superfamily
af_P76330_387_561_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.833 246 386 3.30.70.270
5euhB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8171 246 386 3.30.70.270
4wxwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8153 242 386 3.30.70.270
4zveA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8109 245 386 3.30.70.270
af_P77302_251_409_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8074 246 386 3.30.70.270
ID Description Score Start End GO Terms
AF-A0A7I6VKE2-F1-model_v4 deleted 0.8965 265 386
AF-A0A3M1DA69-F1-model_v4 GGDEF domain-containing protein 0.8801 262 387 GO:0052621
AF-R5HL87-F1-model_v4 deleted 0.8726 251 384
AF-A0A535KMV2-F1-model_v4 GGDEF domain-containing protein 0.8679 260 386 GO:0005886
GO:0043709
GO:0052621
GO:1902201
AF-A0A1F2RW75-F1-model_v4 GGDEF domain-containing protein 0.8459 246 390 GO:0005886
GO:0043709
GO:0052621
GO:1902201

Map