F181959

General Info

Members Datasets Scaffolds Average Seq Length
141 87 276 391

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100150220|Ga0070698_1001502202
Length 435
Sequence MRVAAGASPPPSPASAAGYPDAPGEILPAVARYRRASLIHRVPVSKRGKIVLLHFVGQMPLAGIAWQAVNYLVGLEKLGYETWYVEDHGANPYDPRISSVVMDCEYNLACLRAAMERHGLAGRWAYWDAINDVYHGLSREQVRSLYAEADGLINLCGATQLREEHLRCPVRIMIDTDPVYEQIKYAQADPAARAYVEAHTHFFTYGANLGSPECTIPLSGVPWRATRPPVDLELWPEPSGGSMSDARPCFTTIATWENKGKNIDFDGNSYLWSKHTNFLEFLDLPRQRPQTCFRMAMLPPDETVRRTVEEAGWGLVDPRPVSAGMDPYREFIAGSRGEFTVAKDIYVRPNSGWFSDRAVCYLASGRPVVTMRTGFTTYCPVGHGLFDYASRDEALAAIDAIAADYAGHSRAARDLAGDCFAAERIIAQLLAEVGL

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
56 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
57 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
58 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
59 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
85 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
86 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
87 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.13
Rhizosphere 89.36
Stem 0
Stem Tuber 0
Unclassified 8.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100150220 3300005471 Bacteria 2277
2 rootL2_10062700 3300003322 Bacteria 1459
3 Ga0070683_100254914 3300005329 Unclassified 1669
4 Ga0070680_100002715 3300005336 Bacteria 13123
5 Ga0070680_100030267 3300005336 Bacteria 4350
6 Ga0070675_100042707 3300005354 Bacteria 3705
7 Ga0070709_10007525 3300005434 Bacteria 5973
8 Ga0070709_10012121 3300005434 Bacteria 4820
9 Ga0070714_100009703 3300005435 Bacteria 7582
10 Ga0070713_100006581 3300005436 Bacteria 8075
11 Ga0070710_10002830 3300005437 Bacteria 8275
12 Ga0070711_100001114 3300005439 Bacteria 14370
13 Ga0070711_100006883 3300005439 Bacteria 6890
14 Ga0070711_100105432 3300005439 Bacteria 2059
15 Ga0070681_10007673 3300005458 Bacteria 10552
16 Ga0070681_10051338 3300005458 Bacteria 4113
17 Ga0070706_100039515 3300005467 Bacteria 4356
18 Ga0070707_100016179 3300005468 Bacteria 6999
19 Ga0070707_100311008 3300005468 Bacteria 1531
20 Ga0070698_100013883 3300005471 Bacteria 8519
21 Ga0070698_100346788 3300005471 Bacteria 1416
22 Ga0070699_100001606 3300005518 Bacteria 20637
23 Ga0070699_100038243 3300005518 Bacteria 4155
24 Ga0070699_100284896 3300005518 Bacteria 1480
25 Ga0070679_100007322 3300005530 Bacteria 10311
26 Ga0070679_100007614 3300005530 Bacteria 10136
27 Ga0070679_100012539 3300005530 Bacteria 8106
28 Ga0070679_100196147 3300005530 Bacteria 1986
29 Ga0068857_100087786 3300005577 Bacteria 2782
30 Ga0068856_100168352 3300005614 Unclassified 2202
31 Ga0081540_1015101 3300005983 Bacteria 4902
32 Ga0070717_10000888 3300006028 Bacteria 19780
33 Ga0070716_100021300 3300006173 Bacteria 3414
34 Ga0070712_100002188 3300006175 Bacteria 12013
35 Ga0075436_100017877 3300006914 Bacteria 4855
36 Ga0099795_10019252 3300007788 Bacteria 2206
37 Ga0099795_10031019 3300007788 Bacteria 1838
38 Ga0114129_10528195 3300009147 Bacteria 1537
39 Ga0099796_10004634 3300010159 Bacteria 3350
40 Ga0157370_10002414 3300013104 Bacteria 22522
41 Ga0157370_10028479 3300013104 Bacteria 5493
42 Ga0157369_10003075 3300013105 Bacteria 19928
43 Ga0182008_10052322 3300014497 Unclassified 2024
44 Ga0182008_10075320 3300014497 Bacteria 1660
45 Ga0157379_10003930 3300014968 Bacteria 12665
46 Ga0157379_10088572 3300014968 Bacteria 2776
47 Ga0157376_10152215 3300014969 Bacteria 2087
48 Ga0213872_10024813 3300021361 Bacteria 2757
49 Ga0213872_10087112 3300021361 Unclassified 1399
50 Ga0213876_10062782 3300021384 Bacteria 1961
51 Ga0213875_10000253 3300021388 Bacteria 53621
52 Ga0213875_10002981 3300021388 Bacteria 9858
53 Ga0213875_10003158 3300021388 Bacteria 9476
54 Ga0228598_1003010 3300024227 Bacteria 3656
55 Ga0207692_10089019 3300025898 Unclassified 1670
56 Ga0207699_10020020 3300025906 Bacteria 3579
57 Ga0207699_10174642 3300025906 Bacteria 1440
58 Ga0207684_10006433 3300025910 Bacteria 10706
59 Ga0207684_10062951 3300025910 Bacteria 3150
60 Ga0207707_10005010 3300025912 Bacteria 11634
61 Ga0207693_10001717 3300025915 Bacteria 19248
62 Ga0207693_10002456 3300025915 Bacteria 16102
63 Ga0207693_10121714 3300025915 Bacteria 2049
64 Ga0207663_10058813 3300025916 Bacteria 2428
65 Ga0207660_10021386 3300025917 Bacteria 4350
66 Ga0207652_10018171 3300025921 Bacteria 5763
67 Ga0207652_10086354 3300025921 Bacteria 2751
68 Ga0207646_10012295 3300025922 Bacteria 8233
69 Ga0207659_10195560 3300025926 Bacteria 1612
70 Ga0207700_10050555 3300025928 Bacteria 3098
71 Ga0207700_10308569 3300025928 Unclassified 1368
72 Ga0207664_10007768 3300025929 Bacteria 7448
73 Ga0207664_10049741 3300025929 Bacteria 3302
74 Ga0207644_10067093 3300025931 Bacteria 2614
75 Ga0207665_10007717 3300025939 Bacteria 7103
76 Ga0207711_10311292 3300025941 Bacteria 1454
77 Ga0207702_10024583 3300026078 Bacteria 4999
78 Ga0265338_10154553 3300028800 Bacteria 1779
79 Ga0265327_10000414 3300031251 Bacteria 78352
80 Ga0265327_10019092 3300031251 Bacteria 4227
81 Ga0265316_10068913 3300031344 Bacteria 2731
82 Ga0307416_100383072 3300032002 Unclassified 1437
83 Ga0373926_0011854 3300035083 Bacteria 2942
84 Ga0373936_0017678 3300035113 Bacteria 2747
85 Ga0373954_0023454 3300035118 Bacteria 2806
86 Ga0373956_0011145 3300035119 Bacteria 3702
87 Ga0373957_0005398 3300035120 Bacteria 3959
88 Ga0373931_0005923 3300035691 Bacteria 5684
89 Ga0373935_0023897 3300035692 Bacteria 3756
90 Ga0373927_0061889 3300035695 Bacteria 2421
91 Ga0373927_0148046 3300035695 Bacteria 1537
92 Ga0373933_0009937 3300035724 Bacteria 5209
93 Ga0373947_0009495 3300035725 Bacteria 5586
94 Ga0373947_0022941 3300035725 Bacteria 3625
95 Ga0373947_0160121 3300035725 Unclassified 1455
96 Ga0373937_0001519 3300036401 Bacteria 19499
97 Ga0373937_0006122 3300036401 Bacteria 10359
98 Ga0373937_0015085 3300036401 Bacteria 6826
99 Ga0373937_0062569 3300036401 Bacteria 3421
100 Ga0373925_0009225 3300037068 Bacteria 7181
101 Ga0373925_0053399 3300037068 Bacteria 3021
102 Ga0373925_0214399 3300037068 Bacteria 1534
103 Ga0436364_0266271 3300037853 Bacteria 210347
104 Ga0436364_0335253 3300037853 Bacteria 76277
105 Ga0436364_1149423 3300037853 Bacteria 148108
106 Ga0436364_1472814 3300037853 Unclassified 1725
107 Ga0436365_0300713 3300039437 Bacteria 4344
108 Ga0436365_1385987 3300039437 Bacteria 1693
109 Ga0436360_0398047 3300039438 Bacteria 1441
110 Ga0436360_0737515 3300039438 Bacteria 1779
111 Ga0436360_1260754 3300039438 Bacteria 2072
112 Ga0436361_0601453 3300039447 Bacteria 2055
113 Ga0436361_0666659 3300039447 Bacteria 2912
114 Ga0436361_0863440 3300039447 Unclassified 1370
115 Ga0436361_1157259 3300039447 Bacteria 8415
116 Ga0436363_0315819 3300039450 Bacteria 10475
117 Ga0436362_0413623 3300039453 Bacteria 3520
118 Ga0436362_0813751 3300039453 Bacteria 1676
119 Ga0436362_0866941 3300039453 Bacteria 3122
120 Ga0466963_0083421 3300044694 Bacteria 2168
121 Ga0466967_0152089 3300045976 Bacteria 2164
122 Ga0466967_0251347 3300045976 Bacteria 1689
123 Ga0495592_0058800 3300046454 Unclassified 2834
124 Ga0495580_0001914 3300046472 Bacteria 18300
125 Ga0495658_0077854 3300046683 Bacteria 1940
126 Ga0495600_0121327 3300046809 Bacteria 1700
127 Ga0495680_0045359 3300047322 Bacteria 3471
128 Ga0495684_0215209 3300047471 Bacteria 1411
129 Ga0496104_0261025 3300048907 Bacteria 1645
130 Ga0496112_0039201 3300048915 Unclassified 4628
131 Ga0496113_0012391 3300048916 Bacteria 5729
132 Ga0501083_0011255 3300049744 Bacteria 6276
133 Ga0501083_0019433 3300049744 Bacteria 4734
134 Ga0495595_0065428 3300053084 Bacteria 1710
135 Ga0495619_0000759 3300053085 Bacteria 21040
136 Ga0495619_0039500 3300053085 Bacteria 3081
137 Ga0501082_0025902 3300060353 Bacteria 5055
138 Ga0501082_0038820 3300060353 Bacteria 4107
139 Ga0070698_100150220
140 rootL2_10062700
141 Ga0070683_100254914
142 Ga0070680_100002715
143 Ga0070680_100030267
144 Ga0070675_100042707
145 Ga0070709_10007525
146 Ga0070709_10012121
147 Ga0070714_100009703
148 Ga0070713_100006581
149 Ga0070710_10002830
150 Ga0070711_100001114
151 Ga0070711_100006883
152 Ga0070711_100105432
153 Ga0070681_10007673
154 Ga0070681_10051338
155 Ga0070706_100039515
156 Ga0070707_100016179
157 Ga0070707_100311008
158 Ga0070698_100013883
159 Ga0070698_100346788
160 Ga0070699_100001606
161 Ga0070699_100038243
162 Ga0070699_100284896
163 Ga0070679_100007322
164 Ga0070679_100007614
165 Ga0070679_100012539
166 Ga0070679_100196147
167 Ga0068857_100087786
168 Ga0068856_100168352
169 Ga0081540_1015101
170 Ga0070717_10000888
171 Ga0070716_100021300
172 Ga0070712_100002188
173 Ga0075436_100017877
174 Ga0099795_10019252
175 Ga0099795_10031019
176 Ga0114129_10528195
177 Ga0099796_10004634
178 Ga0157370_10002414
179 Ga0157370_10028479
180 Ga0157369_10003075
181 Ga0182008_10052322
182 Ga0182008_10075320
183 Ga0157379_10003930
184 Ga0157379_10088572
185 Ga0157376_10152215
186 Ga0213872_10024813
187 Ga0213872_10087112
188 Ga0213876_10062782
189 Ga0213875_10000253
190 Ga0213875_10002981
191 Ga0213875_10003158
192 Ga0228598_1003010
193 Ga0207692_10089019
194 Ga0207699_10020020
195 Ga0207699_10174642
196 Ga0207684_10006433
197 Ga0207684_10062951
198 Ga0207707_10005010
199 Ga0207693_10001717
200 Ga0207693_10002456
201 Ga0207693_10121714
202 Ga0207663_10058813
203 Ga0207660_10021386
204 Ga0207652_10018171
205 Ga0207652_10086354
206 Ga0207646_10012295
207 Ga0207659_10195560
208 Ga0207700_10050555
209 Ga0207700_10308569
210 Ga0207664_10007768
211 Ga0207664_10049741
212 Ga0207644_10067093
213 Ga0207665_10007717
214 Ga0207711_10311292
215 Ga0207702_10024583
216 Ga0265338_10154553
217 Ga0265327_10000414
218 Ga0265327_10019092
219 Ga0265316_10068913
220 Ga0307416_100383072
221 Ga0373926_0011854
222 Ga0373936_0017678
223 Ga0373954_0023454
224 Ga0373956_0011145
225 Ga0373957_0005398
226 Ga0373931_0005923
227 Ga0373935_0023897
228 Ga0373927_0061889
229 Ga0373927_0148046
230 Ga0373933_0009937
231 Ga0373947_0009495
232 Ga0373947_0022941
233 Ga0373947_0160121
234 Ga0373937_0001519
235 Ga0373937_0006122
236 Ga0373937_0015085
237 Ga0373937_0062569
238 Ga0373925_0009225
239 Ga0373925_0053399
240 Ga0373925_0214399
241 Ga0436364_0266271
242 Ga0436364_0335253
243 Ga0436364_1149423
244 Ga0436364_1472814
245 Ga0436365_0300713
246 Ga0436365_1385987
247 Ga0436360_0398047
248 Ga0436360_0737515
249 Ga0436360_1260754
250 Ga0436361_0601453
251 Ga0436361_0666659
252 Ga0436361_0863440
253 Ga0436361_1157259
254 Ga0436363_0315819
255 Ga0436362_0413623
256 Ga0436362_0813751
257 Ga0436362_0866941
258 Ga0466963_0083421
259 Ga0466967_0152089
260 Ga0466967_0251347
261 Ga0495592_0058800
262 Ga0495580_0001914
263 Ga0495658_0077854
264 Ga0495600_0121327
265 Ga0495680_0045359
266 Ga0495684_0215209
267 Ga0496104_0261025
268 Ga0496112_0039201
269 Ga0496113_0012391
270 Ga0501083_0011255
271 Ga0501083_0019433
272 Ga0495595_0065428
273 Ga0495619_0000759
274 Ga0495619_0039500
275 Ga0501082_0025902
276 Ga0501082_0038820

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rp7-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae hpxo complexed with fad and uric acid 0.6934 1 46
8p84-assembly1.cif.gz_A x-ray structure of thermoanaerobacterales bacterium monoamine oxidase 0.6826 2 45
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.6818 196 374
5c1p-assembly1.cif.gz_B crystal structure of adp and d-alanyl-d-alanine complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.6804 2 37
1pxb-assembly1.cif.gz_A-2 crystal structures of mutant pseudomonas aeruginosa p-hydroxybenzoate hydroxylase: the tyr201phe, tyr385phe, and asn300asp variants 0.6752 2 41
ID Description Score Start End Superfamily
af_A0A0R0EIF9_8_114_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7263 310 393 3.40.50.2000
af_P9WMY5_198_350_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7009 199 371 3.40.50.2000
2f9fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6924 196 374 3.40.50.2000
4nc9C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6859 197 374 3.40.50.2000
2f9fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6849 196 374 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2V8DWJ7-F1-model_v4 Glycosyltransferase family 1 protein 0.9794 272 390
AF-A0A6M0AEV1-F1-model_v4 Glycosyltransferase family 1 protein 0.9756 291 390 GO:0016740
AF-A0A537YVE4-F1-model_v4 Glycosyltransferase 0.9723 265 390 GO:0016740
AF-A0A2V6S1A1-F1-model_v4 Glycosyltransferase family 1 protein 0.9721 236 390
AF-A0A4Q3WTR2-F1-model_v4 deleted 0.9715 312 392

Map