F180085

General Info

Members Datasets Scaffolds Average Seq Length
140 103 280 126

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_101623819|Ga0307415_1016238191
Length 149
Sequence MPGNAAVSLYRNISCVTRYIALPLLPVNKRSEPDDDKRSIERELKRGSLELIVLHLLASGEAYGYEIVSKLTAETNGALEVTDGTLYPVLYRLERAGSVTVRWETPERGVPRKYYRLTDAGRDELARLTHEWTTFAKAMSKLLRQSREG

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
37 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
57 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
60 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
61 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
62 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
63 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
64 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
65 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
68 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
69 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
80 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
81 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
82 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
83 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
84 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
85 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
86 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
87 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
90 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
98 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
99 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 0.71
Rhizosphere 93.57
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_101623819 3300032126 Bacteria 622
2 Ga0065712_10298859 3300005290 Bacteria 864
3 Ga0065715_10225486 3300005293 Bacteria 1254
4 Ga0065707_10136448 3300005295 Bacteria 1834
5 Ga0068869_100054074 3300005334 Bacteria 2921
6 Ga0070691_10003007 3300005341 Bacteria 7546
7 Ga0070692_10092803 3300005345 Bacteria 1643
8 Ga0070675_100308722 3300005354 Bacteria 1395
9 Ga0070675_101859172 3300005354 Unclassified 555
10 Ga0070674_100026380 3300005356 Bacteria 3794
11 Ga0070674_100794000 3300005356 Unclassified 817
12 Ga0070701_10816714 3300005438 Bacteria 637
13 Ga0070700_100933312 3300005441 Bacteria 709
14 Ga0070694_100461324 3300005444 Bacteria 1005
15 Ga0070694_101292127 3300005444 Bacteria 613
16 Ga0068867_100148810 3300005459 Bacteria 1837
17 Ga0070698_100098604 3300005471 Bacteria 2895
18 Ga0070698_101144662 3300005471 Unclassified 727
19 Ga0070698_101497441 3300005471 Unclassified 626
20 Ga0070699_100198910 3300005518 Bacteria 1782
21 Ga0070695_100007608 3300005545 Bacteria 6418
22 Ga0070695_100063573 3300005545 Bacteria 2399
23 Ga0070695_101375251 3300005545 Bacteria 585
24 Ga0070704_100231867 3300005549 Unclassified 1506
25 Ga0070704_101371733 3300005549 Bacteria 648
26 Ga0070702_100436536 3300005615 Bacteria 946
27 Ga0068860_100811945 3300005843 Bacteria 949
28 Ga0075367_11118047 3300006178 Bacteria 504
29 Ga0075366_10231177 3300006195 Bacteria 1127
30 Ga0097621_100690323 3300006237 Unclassified 939
31 Ga0075428_100524916 3300006844 Bacteria 1266
32 Ga0075428_100676269 3300006844 Bacteria 1100
33 Ga0075430_101111862 3300006846 Unclassified 651
34 Ga0075431_100677873 3300006847 Bacteria 1010
35 Ga0075431_100914427 3300006847 Bacteria 847
36 Ga0075433_10159406 3300006852 Bacteria 2008
37 Ga0075434_100193911 3300006871 Bacteria 2052
38 Ga0075435_100119979 3300007076 Bacteria 2194
39 Ga0111539_10005347 3300009094 Bacteria 16612
40 Ga0111539_10129412 3300009094 Bacteria 2956
41 Ga0111539_10648283 3300009094 Bacteria 1230
42 Ga0111539_11048621 3300009094 Unclassified 948
43 Ga0111539_11643986 3300009094 Bacteria 745
44 Ga0111539_13049877 3300009094 Bacteria 541
45 Ga0114129_10394249 3300009147 Unclassified 1825
46 Ga0114129_10651509 3300009147 Unclassified 1359
47 Ga0105242_11174809 3300009176 Bacteria 785
48 Ga0105248_10168947 3300009177 Bacteria 2465
49 Ga0105249_10043811 3300009553 Bacteria 4070
50 Ga0163162_10244868 3300013306 Bacteria 1924
51 Ga0163162_12132032 3300013306 Bacteria 643
52 Ga0157380_11918677 3300014326 Unclassified 653
53 Ga0157380_12851908 3300014326 Bacteria 550
54 Ga0207673_1003573 3300025290 Bacteria 1825
55 Ga0207645_10886946 3300025907 Bacteria 606
56 Ga0207669_10056093 3300025937 Bacteria 2390
57 Ga0207669_10833478 3300025937 Bacteria 767
58 Ga0207689_10263233 3300025942 Bacteria 1427
59 Ga0207651_10753174 3300025960 Unclassified 861
60 Ga0207712_10043618 3300025961 Bacteria 3095
61 Ga0207648_10032396 3300026089 Bacteria 4615
62 Ga0207675_100218362 3300026118 Bacteria 1836
63 Ga0207683_10344675 3300026121 Bacteria 1367
64 Ga0209974_10299353 3300027876 Unclassified 615
65 Ga0207428_10341668 3300027907 Bacteria 1103
66 Ga0207428_10363735 3300027907 Bacteria 1063
67 Ga0268264_10255382 3300028381 Bacteria 1630
68 Ga0307408_100225426 3300031548 Bacteria 1532
69 Ga0307408_100289172 3300031548 Bacteria 1368
70 Ga0307405_10098433 3300031731 Unclassified 1955
71 Ga0307413_10026975 3300031824 Unclassified 3175
72 Ga0307413_11791909 3300031824 Bacteria 549
73 Ga0307406_10267987 3300031901 Unclassified 1296
74 Ga0307412_10305537 3300031911 Unclassified 1259
75 Ga0307409_102693298 3300031995 Bacteria 525
76 Ga0307416_103133971 3300032002 Bacteria 553
77 Ga0307411_10303851 3300032005 Unclassified 1281
78 Ga0307411_10867141 3300032005 Bacteria 800
79 Ga0307415_100043800 3300032126 Unclassified 2988
80 Ga0307415_101024385 3300032126 Unclassified 769
81 Ga0373956_0170547 3300035119 Bacteria 1027
82 Ga0373955_0695753 3300035172 Bacteria 624
83 Ga0373937_0243469 3300036401 Bacteria 1695
84 Ga0451802_0054807 3300041460 Bacteria 549
85 Ga0450923_059595 3300042125 Bacteria 831
86 Ga0450889_033095 3300042144 Bacteria 609
87 Ga0439435_0200260 3300042436 Unclassified 658
88 Ga0439464_0182750 3300042439 Bacteria 665
89 Ga0450916_002950 3300042530 Bacteria 1844
90 Ga0451577_0013119 3300042876 Bacteria 7767
91 Ga0451576_2636403 3300045051 Bacteria 512
92 Ga0495638_0005583 3300046460 Bacteria 9300
93 Ga0495586_0235887 3300046535 Bacteria 1042
94 Ga0495599_0101058 3300046678 Bacteria 1797
95 Ga0495599_0613087 3300046678 Bacteria 633
96 Ga0495613_0231519 3300046689 Unclassified 1294
97 Ga0501031_0240064 3300049568 Bacteria 1178
98 Ga0501036_0495983 3300049572 Bacteria 1016
99 Ga0501036_1135380 3300049572 Bacteria 638
100 Ga0501037_0407521 3300049573 Bacteria 932
101 Ga0501039_0502132 3300049575 Bacteria 952
102 Ga0501040_0226088 3300049576 Bacteria 1332
103 Ga0501041_0391112 3300049577 Bacteria 880
104 Ga0501042_0020627 3300049578 Bacteria 4588
105 Ga0501048_0519983 3300049582 Bacteria 854
106 Ga0501068_0431283 3300049584 Bacteria 852
107 Ga0501072_0131706 3300049588 Bacteria 1993
108 Ga0501074_0580264 3300049590 Bacteria 793
109 Ga0501075_0011654 3300049591 Bacteria 6228
110 Ga0501075_0869077 3300049591 Bacteria 686
111 Ga0501076_0047450 3300049592 Bacteria 3396
112 Ga0501076_0144449 3300049592 Bacteria 1934
113 Ga0501209_175479 3300049656 Bacteria 653
114 Ga0501261_028222 3300049690 Unclassified 838
115 Ga0501079_0350889 3300049741 Bacteria 1156
116 Ga0501081_0014828 3300049743 Bacteria 5143
117 Ga0501045_0333397 3300049824 Bacteria 1129
118 nmdc:mga0yw44_32274_c1 3300050492 Bacteria 3050
119 nmdc:mga0k408_351841_c1 3300050493 Bacteria 878
120 nmdc:mga0k408_364223_c1 3300050493 Unclassified 861
121 nmdc:mga05p37_71438_c1 3300050507 Bacteria 4269
122 nmdc:mga0qj67_122103_c1 3300050509 Bacteria 2107
123 nmdc:mga0qj67_583196_c1 3300050509 Bacteria 895
124 nmdc:mga08y16_254744_c1 3300050511 Bacteria 1813
125 nmdc:mga08y16_260367_c1 3300050511 Bacteria 1791
126 nmdc:mga08y16_267900_c1 3300050511 Bacteria 1764
127 nmdc:mga08y16_293213_c1 3300050511 Bacteria 1677
128 nmdc:mga08y16_715609_c1 3300050511 Unclassified 1000
129 nmdc:mga0n895_114678_c1 3300050512 Bacteria 2712
130 nmdc:mga0n895_260105_c1 3300050512 Bacteria 1761
131 nmdc:mga0n895_672337_c1 3300050512 Bacteria 1033
132 nmdc:mga0rr50_88224_c1 3300050513 Bacteria 2409
133 nmdc:mga0a205_107703_c1 3300050515 Bacteria 2023
134 Ga0500556_0007240 3300053104 Bacteria 3169
135 Ga0500628_002136 3300053129 Unclassified 3303
136 Ga0500611_117907 3300053727 Unclassified 704
137 Ga0501084_0367447 3300054114 Bacteria 1216
138 Ga0590075_031273 3300059424 Unclassified 1350
139 Ga0501082_0121584 3300060353 Bacteria 2263
140 Ga0530510_0379963 3300061734 Bacteria 1063
141 Ga0307415_101623819
142 Ga0065712_10298859
143 Ga0065715_10225486
144 Ga0065707_10136448
145 Ga0068869_100054074
146 Ga0070691_10003007
147 Ga0070692_10092803
148 Ga0070675_100308722
149 Ga0070675_101859172
150 Ga0070674_100026380
151 Ga0070674_100794000
152 Ga0070701_10816714
153 Ga0070700_100933312
154 Ga0070694_100461324
155 Ga0070694_101292127
156 Ga0068867_100148810
157 Ga0070698_100098604
158 Ga0070698_101144662
159 Ga0070698_101497441
160 Ga0070699_100198910
161 Ga0070695_100007608
162 Ga0070695_100063573
163 Ga0070695_101375251
164 Ga0070704_100231867
165 Ga0070704_101371733
166 Ga0070702_100436536
167 Ga0068860_100811945
168 Ga0075367_11118047
169 Ga0075366_10231177
170 Ga0097621_100690323
171 Ga0075428_100524916
172 Ga0075428_100676269
173 Ga0075430_101111862
174 Ga0075431_100677873
175 Ga0075431_100914427
176 Ga0075433_10159406
177 Ga0075434_100193911
178 Ga0075435_100119979
179 Ga0111539_10005347
180 Ga0111539_10129412
181 Ga0111539_10648283
182 Ga0111539_11048621
183 Ga0111539_11643986
184 Ga0111539_13049877
185 Ga0114129_10394249
186 Ga0114129_10651509
187 Ga0105242_11174809
188 Ga0105248_10168947
189 Ga0105249_10043811
190 Ga0163162_10244868
191 Ga0163162_12132032
192 Ga0157380_11918677
193 Ga0157380_12851908
194 Ga0207673_1003573
195 Ga0207645_10886946
196 Ga0207669_10056093
197 Ga0207669_10833478
198 Ga0207689_10263233
199 Ga0207651_10753174
200 Ga0207712_10043618
201 Ga0207648_10032396
202 Ga0207675_100218362
203 Ga0207683_10344675
204 Ga0209974_10299353
205 Ga0207428_10341668
206 Ga0207428_10363735
207 Ga0268264_10255382
208 Ga0307408_100225426
209 Ga0307408_100289172
210 Ga0307405_10098433
211 Ga0307413_10026975
212 Ga0307413_11791909
213 Ga0307406_10267987
214 Ga0307412_10305537
215 Ga0307409_102693298
216 Ga0307416_103133971
217 Ga0307411_10303851
218 Ga0307411_10867141
219 Ga0307415_100043800
220 Ga0307415_101024385
221 Ga0373956_0170547
222 Ga0373955_0695753
223 Ga0373937_0243469
224 Ga0451802_0054807
225 Ga0450923_059595
226 Ga0450889_033095
227 Ga0439435_0200260
228 Ga0439464_0182750
229 Ga0450916_002950
230 Ga0451577_0013119
231 Ga0451576_2636403
232 Ga0495638_0005583
233 Ga0495586_0235887
234 Ga0495599_0101058
235 Ga0495599_0613087
236 Ga0495613_0231519
237 Ga0501031_0240064
238 Ga0501036_0495983
239 Ga0501036_1135380
240 Ga0501037_0407521
241 Ga0501039_0502132
242 Ga0501040_0226088
243 Ga0501041_0391112
244 Ga0501042_0020627
245 Ga0501048_0519983
246 Ga0501068_0431283
247 Ga0501072_0131706
248 Ga0501074_0580264
249 Ga0501075_0011654
250 Ga0501075_0869077
251 Ga0501076_0047450
252 Ga0501076_0144449
253 Ga0501209_175479
254 Ga0501261_028222
255 Ga0501079_0350889
256 Ga0501081_0014828
257 Ga0501045_0333397
258 nmdc:mga0yw44_32274_c1
259 nmdc:mga0k408_351841_c1
260 nmdc:mga0k408_364223_c1
261 nmdc:mga05p37_71438_c1
262 nmdc:mga0qj67_122103_c1
263 nmdc:mga0qj67_583196_c1
264 nmdc:mga08y16_254744_c1
265 nmdc:mga08y16_260367_c1
266 nmdc:mga08y16_267900_c1
267 nmdc:mga08y16_293213_c1
268 nmdc:mga08y16_715609_c1
269 nmdc:mga0n895_114678_c1
270 nmdc:mga0n895_260105_c1
271 nmdc:mga0n895_672337_c1
272 nmdc:mga0rr50_88224_c1
273 nmdc:mga0a205_107703_c1
274 Ga0500556_0007240
275 Ga0500628_002136
276 Ga0500611_117907
277 Ga0501084_0367447
278 Ga0590075_031273
279 Ga0501082_0121584
280 Ga0530510_0379963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

53

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9144 16 115
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9069 16 115
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.905 16 118
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.8947 16 117
6abt-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8943 19 115
ID Description Score Start End Superfamily
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9214 21 101 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9166 26 92 1.10.10.10
3hhhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9036 16 114 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8976 22 101 1.10.10.10
3l9fD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8768 23 101 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V9SMK9-F1-model_v4 PadR family transcriptional regulator 0.9692 22 102
AF-A0A7C4F5B4-F1-model_v4 PadR family transcriptional regulator 0.9675 14 115
AF-A0A534THG7-F1-model_v4 PadR family transcriptional regulator 0.9669 21 104
AF-A0A7J2Y7M2-F1-model_v4 PadR family transcriptional regulator 0.9604 12 119
AF-G7WHP6-F1-model_v4 Putative transcriptional regulator 0.9597 23 103

Map