F179009

General Info

Members Datasets Scaffolds Average Seq Length
140 105 140 212

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100159858|Ga0068858_1001598582
Length 265
Sequence MILITVMSGRKSALSSTNWSGLTSAATVSNSIPVACSWFSAITSARMKQLLQPLLDWYLQSLKSGGYPLVALLMAIESSIVPLPSEVVIPPAAHLAWTEGLDFLGVRFTGWSAQFGLVIAGTIGSWLGATAMYWVSRVAGRPIVMKYGKYVFISAAKVEGAERWAASYGAFGIFASRLLPVVRHLIGIPAGIVRMSYLTFSIYTLLGSAVWCGVLCWLGVKIGANISHGDMQKVTIWILGFLLAVGVMYYLFVHRQMKRKPDQNG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
57 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
58 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
59 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
60 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
61 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
62 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
63 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
64 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
87 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 0.71
Rhizosphere 98.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100111156 3300005329 Bacteria 2585
2 Ga0070690_100039974 3300005330 Bacteria 2965
3 Ga0070675_100517278 3300005354 Unclassified 1077
4 Ga0070714_100020931 3300005435 Bacteria 5347
5 Ga0070713_100525062 3300005436 Unclassified 1119
6 Ga0070711_100010214 3300005439 Bacteria 5803
7 Ga0070708_100455199 3300005445 Bacteria 1207
8 Ga0070679_100067343 3300005530 Bacteria 3570
9 Ga0068855_100095881 3300005563 Unclassified 3419
10 Ga0068857_100002094 3300005577 Bacteria 16222
11 Ga0068852_100295518 3300005616 Bacteria 1566
12 Ga0068864_100217392 3300005618 Bacteria 1762
13 Ga0068863_100761606 3300005841 Bacteria 964
14 Ga0068858_100159858 3300005842 Bacteria 2121
15 Ga0068860_100661167 3300005843 Unclassified 1053
16 Ga0081455_10121207 3300005937 Bacteria 2060
17 Ga0070712_100198302 3300006175 Unclassified 1575
18 Ga0097621_100042483 3300006237 Unclassified 3662
19 Ga0068871_100045713 3300006358 Unclassified 3525
20 Ga0068871_100444325 3300006358 Unclassified 1161
21 Ga0075434_100709589 3300006871 Bacteria 1023
22 Ga0099795_10155383 3300007788 Unclassified 940
23 Ga0105240_10795507 3300009093 Unclassified 1025
24 Ga0105245_10349443 3300009098 Bacteria 1465
25 Ga0105241_10206593 3300009174 Unclassified 1643
26 Ga0105238_10159250 3300009551 Unclassified 2233
27 Ga0105238_10334889 3300009551 Bacteria 1501
28 Ga0157370_10317905 3300013104 Bacteria 1436
29 Ga0157370_10357553 3300013104 Unclassified 1346
30 Ga0157370_10679436 3300013104 Unclassified 940
31 Ga0157374_10827070 3300013296 Unclassified 942
32 Ga0157375_10000049 3300013308 Bacteria 139586
33 Ga0163163_10000375 3300014325 Bacteria 42824
34 Ga0163163_10312892 3300014325 Bacteria 1624
35 Ga0207705_10386614 3300025909 Bacteria 1081
36 Ga0207654_10243739 3300025911 Bacteria 1202
37 Ga0207695_10104354 3300025913 Unclassified 2824
38 Ga0207695_10572082 3300025913 Unclassified 1011
39 Ga0207663_10000803 3300025916 Bacteria 14114
40 Ga0207652_10356861 3300025921 Bacteria 1319
41 Ga0207652_10728419 3300025921 Bacteria 884
42 Ga0207659_10539212 3300025926 Bacteria 991
43 Ga0207664_10001721 3300025929 Bacteria 14416
44 Ga0207661_10569772 3300025944 Bacteria 1038
45 Ga0207703_10175305 3300026035 Bacteria 1889
46 Ga0207641_10188126 3300026088 Bacteria 1896
47 Ga0207641_10848840 3300026088 Bacteria 905
48 Ga0207676_10062460 3300026095 Bacteria 2955
49 Ga0207674_10002014 3300026116 Bacteria 25815
50 Ga0265337_1000520 3300028556 Bacteria 20388
51 Ga0265319_1000003 3300028563 Bacteria 340561
52 Ga0265334_10007332 3300028573 Unclassified 4733
53 Ga0265323_10002794 3300028653 Bacteria 7854
54 Ga0265322_10001133 3300028654 Bacteria 9160
55 Ga0265338_10001406 3300028800 Bacteria 39189
56 Ga0265338_10008057 3300028800 Bacteria 12886
57 Ga0265338_10014623 3300028800 Bacteria 8708
58 Ga0265338_10023584 3300028800 Bacteria 6321
59 Ga0265338_10027297 3300028800 Bacteria 5731
60 Ga0265338_10068608 3300028800 Unclassified 3053
61 Ga0265338_10134605 3300028800 Unclassified 1945
62 Ga0265338_10579529 3300028800 Bacteria 783
63 Ga0265332_10032130 3300031238 Bacteria 2288
64 Ga0265320_10002114 3300031240 Bacteria 13963
65 Ga0265320_10010462 3300031240 Bacteria 5527
66 Ga0265325_10108706 3300031241 Unclassified 1350
67 Ga0265340_10206928 3300031247 Bacteria 882
68 Ga0265327_10050429 3300031251 Unclassified 2178
69 Ga0265327_10065465 3300031251 Bacteria 1838
70 Ga0265327_10278699 3300031251 Bacteria 739
71 Ga0265316_10049502 3300031344 Bacteria 3310
72 Ga0265316_10085218 3300031344 Unclassified 2418
73 Ga0265316_10113732 3300031344 Unclassified 2048
74 Ga0265313_10003706 3300031595 Bacteria 12166
75 Ga0265314_10388434 3300031711 Bacteria 758
76 Ga0316577_10190512 3300031733 Bacteria 1159
77 Ga0373930_0017633 3300034816 Bacteria 1363
78 Ga0373928_0000591 3300035084 Bacteria 7119
79 Ga0373944_0001716 3300035089 Bacteria 5546
80 Ga0373949_0005558 3300035090 Unclassified 2810
81 Ga0373951_0003604 3300035091 Unclassified 3734
82 Ga0373932_0000004 3300035112 Bacteria 412176
83 Ga0373946_0070116 3300035171 Unclassified 1512
84 Ga0373962_0001295 3300035242 Bacteria 5877
85 Ga0316574_0161694 3300035398 Unclassified 1442
86 Ga0373931_0000018 3300035691 Bacteria 190282
87 Ga0373931_0058506 3300035691 Bacteria 2070
88 Ga0373927_0007847 3300035695 Bacteria 7218
89 Ga0373947_0039211 3300035725 Bacteria 2818
90 Ga0373947_0228055 3300035725 Bacteria 1226
91 Ga0373937_0107417 3300036401 Unclassified 2595
92 Ga0373925_0007692 3300037068 Bacteria 7848
93 Ga0453684_0010695 3300044712 Bacteria 15606
94 Ga0451576_0095331 3300045051 Bacteria 3095
95 Ga0451576_0096356 3300045051 Bacteria 3078
96 Ga0451576_0181983 3300045051 Bacteria 2194
97 Ga0451576_0316868 3300045051 Unclassified 1632
98 Ga0451576_0419001 3300045051 Bacteria 1405
99 Ga0451576_1134143 3300045051 Unclassified 818
100 Ga0495651_0120534 3300046462 Unclassified 1928
101 Ga0495582_0073448 3300046473 Bacteria 1893
102 Ga0495582_0076303 3300046473 Bacteria 1858
103 Ga0495639_0086494 3300046475 Bacteria 1466
104 Ga0495664_0278203 3300046477 Unclassified 1011
105 Ga0495618_0043312 3300046514 Bacteria 2840
106 Ga0495628_0113974 3300046516 Bacteria 2078
107 Ga0495630_0000396 3300046517 Bacteria 34306
108 Ga0495666_0010131 3300046526 Bacteria 4703
109 Ga0495640_0135032 3300046533 Bacteria 1594
110 Ga0495586_0000259 3300046535 Bacteria 34693
111 Ga0495586_0256984 3300046535 Unclassified 997
112 Ga0495645_0118262 3300046543 Unclassified 1869
113 Ga0495645_0149153 3300046543 Bacteria 1626
114 Ga0495645_0208512 3300046543 Unclassified 1321
115 Ga0495645_0302744 3300046543 Unclassified 1044
116 Ga0495634_0150974 3300046642 Bacteria 1469
117 Ga0495635_0040017 3300046663 Bacteria 3241
118 Ga0495599_0312542 3300046678 Bacteria 947
119 Ga0495647_0004925 3300046681 Bacteria 4372
120 Ga0495647_0037910 3300046681 Bacteria 1821
121 Ga0495658_0156093 3300046683 Unclassified 1404
122 Ga0495613_0039147 3300046689 Bacteria 3515
123 Ga0495581_0238024 3300047315 Unclassified 1064
124 Ga0495674_0001383 3300047319 Bacteria 23681
125 Ga0495676_0095067 3300047321 Bacteria 2219
126 Ga0495675_0244541 3300047444 Unclassified 1079
127 Ga0495684_0121707 3300047471 Bacteria 1965
128 Ga0496115_0015042 3300048918 Bacteria 5865
129 Ga0501031_0000084 3300049568 Bacteria 50157
130 Ga0501031_0391521 3300049568 Bacteria 899
131 Ga0501032_0000573 3300049569 Bacteria 29789
132 Ga0501033_0001493 3300049570 Bacteria 20721
133 Ga0501039_0462463 3300049575 Unclassified 996
134 Ga0501043_0537528 3300049579 Unclassified 870
135 Ga0501070_0413299 3300049586 Bacteria 1090
136 Ga0501035_0009225 3300049822 Bacteria 9174
137 Ga0501035_0069035 3300049822 Unclassified 3133
138 Ga0501044_0002482 3300049823 Bacteria 21042
139 nmdc:mga0n895_264793_c1 3300050512 Bacteria 1744
140 Ga0500650_0003378 3300053098 Bacteria 5540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046678 Ga0495599_0312542 Ga0495599_0312542_252_878 197
2 3300005330 Ga0070690_100039974 Ga0070690_1000399743 199
3 3300013308 Ga0157375_10000049 Ga0157375_1000004999 199
4 3300031711 Ga0265314_10388434 Ga0265314_103884341 202
5 3300005937 Ga0081455_10121207 Ga0081455_101212071 203
6 3300031733 Ga0316577_10190512 Ga0316577_101905122 203
7 3300035398 Ga0316574_0161694 Ga0316574_0161694_674_1336 203
8 3300046462 Ga0495651_0120534 Ga0495651_0120534_454_1065 203
9 3300046477 Ga0495664_0278203 Ga0495664_0278203_254_865 203
10 3300046543 Ga0495645_0208512 Ga0495645_0208512_243_854 203
11 3300035725 Ga0373947_0039211 Ga0373947_0039211_1815_2450 204
12 3300045051 Ga0451576_0096356 Ga0451576_0096356_2045_2695 204
13 3300046473 Ga0495582_0076303 Ga0495582_0076303_362_997 204
14 3300046514 Ga0495618_0043312 Ga0495618_0043312_1184_1819 204
15 3300046517 Ga0495630_0000396 Ga0495630_0000396_12411_13046 204
16 3300046526 Ga0495666_0010131 Ga0495666_0010131_1158_1793 204
17 3300046535 Ga0495586_0000259 Ga0495586_0000259_12806_13441 204
18 3300046642 Ga0495634_0150974 Ga0495634_0150974_160_795 204
19 3300046681 Ga0495647_0037910 Ga0495647_0037910_11_646 204
20 3300046683 Ga0495658_0156093 Ga0495658_0156093_450_1085 204
21 3300046689 Ga0495613_0039147 Ga0495613_0039147_2726_3361 204
22 3300047315 Ga0495581_0238024 Ga0495581_0238024_381_1016 204
23 3300047319 Ga0495674_0001383 Ga0495674_0001383_2586_3221 204
24 3300047321 Ga0495676_0095067 Ga0495676_0095067_158_793 204
25 3300005354 Ga0070675_100517278 Ga0070675_1005172782 205
26 3300005436 Ga0070713_100525062 Ga0070713_1005250622 205
27 3300005563 Ga0068855_100095881 Ga0068855_1000958813 205
28 3300005577 Ga0068857_100002094 Ga0068857_10000209410 205
29 3300005616 Ga0068852_100295518 Ga0068852_1002955181 205
30 3300005618 Ga0068864_100217392 Ga0068864_1002173923 205
31 3300005843 Ga0068860_100661167 Ga0068860_1006611672 205
32 3300006175 Ga0070712_100198302 Ga0070712_1001983022 205
33 3300006237 Ga0097621_100042483 Ga0097621_1000424833 205
34 3300006358 Ga0068871_100045713 Ga0068871_1000457132 205
35 3300006358 Ga0068871_100444325 Ga0068871_1004443252 205
36 3300006871 Ga0075434_100709589 Ga0075434_1007095892 205
37 3300007788 Ga0099795_10155383 Ga0099795_101553831 205
38 3300009098 Ga0105245_10349443 Ga0105245_103494431 205
39 3300009174 Ga0105241_10206593 Ga0105241_102065932 205
40 3300009551 Ga0105238_10159250 Ga0105238_101592502 205
41 3300013104 Ga0157370_10317905 Ga0157370_103179052 205
42 3300013296 Ga0157374_10827070 Ga0157374_108270701 205
43 3300014325 Ga0163163_10000375 Ga0163163_1000037524 205
44 3300014325 Ga0163163_10312892 Ga0163163_103128921 205
45 3300025911 Ga0207654_10243739 Ga0207654_102437392 205
46 3300025913 Ga0207695_10104354 Ga0207695_101043543 205
47 3300025921 Ga0207652_10728419 Ga0207652_107284192 205
48 3300025926 Ga0207659_10539212 Ga0207659_105392122 205
49 3300026088 Ga0207641_10188126 Ga0207641_101881262 205
50 3300026095 Ga0207676_10062460 Ga0207676_100624602 205
51 3300026116 Ga0207674_10002014 Ga0207674_1000201417 205
52 3300028800 Ga0265338_10001406 Ga0265338_1000140616 205
53 3300028800 Ga0265338_10014623 Ga0265338_100146237 205
54 3300035691 Ga0373931_0058506 Ga0373931_0058506_1141_1761 205
55 3300036401 Ga0373937_0107417 Ga0373937_0107417_1923_2555 205
56 3300044712 Ga0453684_0010695 Ga0453684_0010695_5700_6362 205
57 3300045051 Ga0451576_0095331 Ga0451576_0095331_205_831 205
58 3300045051 Ga0451576_0181983 Ga0451576_0181983_494_1114 205
59 3300045051 Ga0451576_0316868 Ga0451576_0316868_822_1472 205
60 3300045051 Ga0451576_1134143 Ga0451576_1134143_137_757 205
61 3300046473 Ga0495582_0073448 Ga0495582_0073448_950_1576 205
62 3300046475 Ga0495639_0086494 Ga0495639_0086494_265_891 205
63 3300046533 Ga0495640_0135032 Ga0495640_0135032_122_748 205
64 3300046535 Ga0495586_0256984 Ga0495586_0256984_298_924 205
65 3300046543 Ga0495645_0118262 Ga0495645_0118262_274_894 205
66 3300046663 Ga0495635_0040017 Ga0495635_0040017_1845_2468 205
67 3300046681 Ga0495647_0004925 Ga0495647_0004925_73_699 205
68 3300048918 Ga0496115_0015042 Ga0496115_0015042_1173_1790 205
69 3300050512 nmdc:mga0n895_264793_c1 nmdc:mga0n895_264793_c1_160_810 205
70 3300028800 Ga0265338_10579529 Ga0265338_105795291 206
71 3300005842 Ga0068858_100159858 Ga0068858_1001598582 207
72 3300026035 Ga0207703_10175305 Ga0207703_101753052 207
73 3300028556 Ga0265337_1000520 Ga0265337_100052015 207
74 3300028653 Ga0265323_10002794 Ga0265323_1000279410 207
75 3300028654 Ga0265322_10001133 Ga0265322_100011337 207
76 3300031344 Ga0265316_10049502 Ga0265316_100495025 207
77 3300031344 Ga0265316_10113732 Ga0265316_101137322 207
78 3300028800 Ga0265338_10008057 Ga0265338_100080577 208
79 3300031238 Ga0265332_10032130 Ga0265332_100321302 208
80 3300031240 Ga0265320_10002114 Ga0265320_100021147 208
81 3300031241 Ga0265325_10108706 Ga0265325_101087062 208
82 3300031247 Ga0265340_10206928 Ga0265340_102069281 208
83 3300031251 Ga0265327_10050429 Ga0265327_100504292 208
84 3300031251 Ga0265327_10065465 Ga0265327_100654652 208
85 3300031251 Ga0265327_10278699 Ga0265327_102786991 208
86 3300031344 Ga0265316_10085218 Ga0265316_100852182 208
87 3300034816 Ga0373930_0017633 Ga0373930_0017633_377_1030 208
88 3300035084 Ga0373928_0000591 Ga0373928_0000591_3711_4364 208
89 3300035089 Ga0373944_0001716 Ga0373944_0001716_2126_2779 208
90 3300035090 Ga0373949_0005558 Ga0373949_0005558_960_1613 208
91 3300035091 Ga0373951_0003604 Ga0373951_0003604_1633_2286 208
92 3300035112 Ga0373932_0000004 Ga0373932_0000004_2755_3408 208
93 3300035171 Ga0373946_0070116 Ga0373946_0070116_108_761 208
94 3300035242 Ga0373962_0001295 Ga0373962_0001295_2469_3122 208
95 3300035691 Ga0373931_0000018 Ga0373931_0000018_186874_187527 208
96 3300035695 Ga0373927_0007847 Ga0373927_0007847_424_1077 208
97 3300035725 Ga0373947_0228055 Ga0373947_0228055_310_963 208
98 3300037068 Ga0373925_0007692 Ga0373925_0007692_2753_3406 208
99 3300005329 Ga0070683_100111156 Ga0070683_1001111562 209
100 3300005435 Ga0070714_100020931 Ga0070714_1000209314 209
101 3300005439 Ga0070711_100010214 Ga0070711_1000102147 209
102 3300005445 Ga0070708_100455199 Ga0070708_1004551991 209
103 3300005530 Ga0070679_100067343 Ga0070679_1000673433 209
104 3300005841 Ga0068863_100761606 Ga0068863_1007616062 209
105 3300009093 Ga0105240_10795507 Ga0105240_107955072 209
106 3300009551 Ga0105238_10334889 Ga0105238_103348892 209
107 3300013104 Ga0157370_10357553 Ga0157370_103575531 209
108 3300013104 Ga0157370_10679436 Ga0157370_106794362 209
109 3300025909 Ga0207705_10386614 Ga0207705_103866142 209
110 3300025913 Ga0207695_10572082 Ga0207695_105720822 209
111 3300025916 Ga0207663_10000803 Ga0207663_1000080311 209
112 3300025921 Ga0207652_10356861 Ga0207652_103568612 209
113 3300025929 Ga0207664_10001721 Ga0207664_100017214 209
114 3300025944 Ga0207661_10569772 Ga0207661_105697722 209
115 3300026088 Ga0207641_10848840 Ga0207641_108488402 209
116 3300028563 Ga0265319_1000003 Ga0265319_1000003223 209
117 3300028573 Ga0265334_10007332 Ga0265334_100073322 209
118 3300028800 Ga0265338_10023584 Ga0265338_100235844 209
119 3300028800 Ga0265338_10027297 Ga0265338_100272976 209
120 3300028800 Ga0265338_10068608 Ga0265338_100686082 209
121 3300028800 Ga0265338_10134605 Ga0265338_101346052 209
122 3300031240 Ga0265320_10010462 Ga0265320_100104622 209
123 3300031595 Ga0265313_10003706 Ga0265313_100037068 209
124 3300045051 Ga0451576_0419001 Ga0451576_0419001_701_1354 209
125 3300046516 Ga0495628_0113974 Ga0495628_0113974_857_1522 209
126 3300046543 Ga0495645_0149153 Ga0495645_0149153_176_841 209
127 3300046543 Ga0495645_0302744 Ga0495645_0302744_191_868 209
128 3300047444 Ga0495675_0244541 Ga0495675_0244541_50_715 209
129 3300047471 Ga0495684_0121707 Ga0495684_0121707_34_699 209
130 3300049568 Ga0501031_0000084 Ga0501031_0000084_28271_28900 209
131 3300049568 Ga0501031_0391521 Ga0501031_0391521_13_645 209
132 3300049569 Ga0501032_0000573 Ga0501032_0000573_13967_14596 209
133 3300049570 Ga0501033_0001493 Ga0501033_0001493_17931_18560 209
134 3300049575 Ga0501039_0462463 Ga0501039_0462463_210_839 209
135 3300049579 Ga0501043_0537528 Ga0501043_0537528_162_794 209
136 3300049586 Ga0501070_0413299 Ga0501070_0413299_82_714 209
137 3300049822 Ga0501035_0009225 Ga0501035_0009225_6496_7128 209
138 3300049822 Ga0501035_0069035 Ga0501035_0069035_1069_1698 209
139 3300049823 Ga0501044_0002482 Ga0501044_0002482_18262_18891 209
140 3300053098 Ga0500650_0003378 Ga0500650_0003378_3193_3822 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

98

221

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8s9d-assembly1.cif.gz_A-2 c143s variant of citrate synthase (cita) in mycobacterium tuberculosis 0.3562 25 169
3tds-assembly1.cif.gz_E crystal structure of hsc f194i 0.3248 45 169
2b5f-assembly1.cif.gz_C crystal structure of the spinach aquaporin sopip2;1 in an open conformation to 3.9 resolution 0.3227 45 169
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.3225 11 169
3cn5-assembly1.cif.gz_A crystal structure of the spinach aquaporin sopip2;1 s115e, s274e mutant 0.3097 21 169
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8607 40 166 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8265 40 166 1.10.1760.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3449 17 204 1.20.1250.20
af_A0A0R4IIL3_31_257_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.3333 18 178 1.20.1080.10
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3197 17 204 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V5SYP6-F1-model_v4 DedA family protein 0.9271 7 168 GO:0005886
AF-A0A535SXX6-F1-model_v4 DedA family protein 0.9244 6 171 GO:0005886
AF-A0A1V6GCL9-F1-model_v4 deleted 0.9207 1 206
AF-A0A1V6DJB0-F1-model_v4 deleted 0.908 3 208
AF-A0A2V5SYP6-F1-model_v4 DedA family protein 0.9054 7 168 GO:0005886

Feature Viewer

pLDDT pTM Quality
75.84 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map