F177724

General Info

Members Datasets Scaffolds Average Seq Length
139 91 278 210

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0493882|Ga0501035_0493882_92_841
Length 249
Sequence MMWWVEPPAAPAPLVLTSGLPGASPVSRPGPVSKGRTAMNVGSYSALDASVLVLNKTFMAIHVISVRRAFCLLCKDLAEVVSLEDGQFATYDFASWAELSAFRAANFRQEEDDWVRTPTSEILSPRVIRLLSYDKLPKQTVKFNRRNIFARDHNQCQYCGKRFPTTELSLDHVIPRSQGGGTTWDNIVCACVDCNVRKGGRTPRQANMTLIRKPEKPKRSPMLNIKLSQKKYQSWQSFIDNAYWNVELK

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
24 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
37 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
40 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
41 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
42 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
43 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
44 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
45 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
46 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
47 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
48 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
57 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
61 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
62 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
63 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
64 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
65 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
66 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
73 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
81 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
84 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
85 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
86 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
87 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
88 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
89 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.53
Metatranscriptomes 5.76
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.47
Rhizosphere 84.89
Stem 0
Stem Tuber 0
Unclassified 10.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0493882 3300049822 Bacteria 1008
2 Ga0058863_11803259 3300004799 Bacteria 1307
3 Ga0058861_11958931 3300004800 Bacteria 738
4 Ga0058862_12736463 3300004803 Bacteria 720
5 Ga0070662_100663758 3300005457 Unclassified 880
6 Ga0070681_10273107 3300005458 Bacteria 1602
7 Ga0070681_10872707 3300005458 Unclassified 818
8 Ga0070706_100325556 3300005467 Bacteria 1433
9 Ga0070665_100002119 3300005548 Bacteria 22153
10 Ga0068855_100260472 3300005563 Bacteria 1932
11 Ga0068854_100320484 3300005578 Bacteria 1260
12 Ga0068856_100473204 3300005614 Bacteria 1274
13 Ga0068852_100180902 3300005616 Bacteria 1982
14 Ga0068860_100041354 3300005843 Bacteria 4403
15 Ga0068860_101140973 3300005843 Bacteria 799
16 Ga0075428_100003946 3300006844 Bacteria 16276
17 Ga0075428_100512922 3300006844 Bacteria 1282
18 Ga0105240_11266183 3300009093 Bacteria 779
19 Ga0105248_10156667 3300009177 Unclassified 2570
20 Ga0105237_10029504 3300009545 Bacteria 5575
21 Ga0105238_10842604 3300009551 Bacteria 934
22 Ga0105239_10139062 3300010375 Bacteria 2705
23 Ga0105239_10292932 3300010375 Bacteria 1833
24 Ga0157374_10433336 3300013296 Bacteria 1314
25 Ga0206352_11078464 3300020078 Bacteria 737
26 Ga0206350_10353757 3300020080 Bacteria 916
27 Ga0206350_10873940 3300020080 Bacteria 743
28 Ga0213873_10000851 3300021358 Bacteria 4909
29 Ga0207684_10276711 3300025910 Bacteria 1448
30 Ga0207707_10461848 3300025912 Bacteria 1086
31 Ga0207671_10009760 3300025914 Bacteria 7989
32 Ga0207652_10219105 3300025921 Bacteria 1715
33 Ga0207694_10642582 3300025924 Bacteria 894
34 Ga0207700_10236376 3300025928 Bacteria 1556
35 Ga0207644_10595315 3300025931 Bacteria 918
36 Ga0207667_10135117 3300025949 Bacteria 2540
37 Ga0207702_10387825 3300026078 Bacteria 1344
38 Ga0207683_10837382 3300026121 Bacteria 854
39 Ga0268266_10004109 3300028379 Bacteria 14056
40 Ga0268266_10507537 3300028379 Bacteria 1152
41 Ga0268264_10178206 3300028381 Bacteria 1928
42 Ga0268264_10940945 3300028381 Bacteria 869
43 Ga0265319_1042365 3300028563 Bacteria 1532
44 Ga0265318_10139671 3300028577 Bacteria 890
45 Ga0265338_10297821 3300028800 Unclassified 1173
46 Ga0265332_10018095 3300031238 Unclassified 3106
47 Ga0265325_10000983 3300031241 Bacteria 20455
48 Ga0265325_10043448 3300031241 Bacteria 2345
49 Ga0265339_10000169 3300031249 Bacteria 55142
50 Ga0265339_10179929 3300031249 Bacteria 1053
51 Ga0265331_10000111 3300031250 Bacteria 108277
52 Ga0265313_10001247 3300031595 Bacteria 24234
53 Ga0265314_10000082 3300031711 Bacteria 143717
54 Ga0265314_10005674 3300031711 Bacteria 11205
55 Ga0265314_10223208 3300031711 Unclassified 1098
56 Ga0265342_10008188 3300031712 Bacteria 7538
57 Ga0316574_0476846 3300035398 Bacteria 780
58 Ga0373937_0422007 3300036401 Bacteria 1266
59 Ga0373925_0673412 3300037068 Bacteria 853
60 Ga0395900_1322985 3300037418 Bacteria 634
61 Ga0395905_0120811 3300037471 Bacteria 2463
62 Ga0436364_0657780 3300037853 Bacteria 758
63 Ga0436364_0685097 3300037853 Bacteria 1031
64 Ga0436364_1199249 3300037853 Bacteria 928
65 Ga0395901_0217961 3300038443 Bacteria 1995
66 Ga0436365_0375898 3300039437 Bacteria 717
67 Ga0436365_0451999 3300039437 Bacteria 850
68 Ga0436365_0460046 3300039437 Bacteria 1080
69 Ga0436365_1017444 3300039437 Bacteria 1216
70 Ga0436365_1195647 3300039437 Bacteria 857
71 Ga0436365_1479675 3300039437 Bacteria 903
72 Ga0436360_0033111 3300039438 Bacteria 738
73 Ga0436360_0141892 3300039438 Bacteria 846
74 Ga0436360_0220182 3300039438 Bacteria 745
75 Ga0436360_0584304 3300039438 Bacteria 7049
76 Ga0436360_0921827 3300039438 Bacteria 780
77 Ga0436360_1301184 3300039438 Bacteria 1732
78 Ga0436360_1351190 3300039438 Bacteria 735
79 Ga0436361_0012120 3300039447 Bacteria 850
80 Ga0436361_0216573 3300039447 Bacteria 722
81 Ga0436361_0889124 3300039447 Bacteria 793
82 Ga0436361_1172909 3300039447 Bacteria 867
83 Ga0436363_0798649 3300039450 Bacteria 860
84 Ga0436363_1612118 3300039450 Bacteria 1073
85 Ga0436362_0170323 3300039453 Bacteria 820
86 Ga0436362_0234214 3300039453 Bacteria 772
87 Ga0436362_0284143 3300039453 Bacteria 754
88 Ga0436362_0693913 3300039453 Bacteria 786
89 Ga0436362_1264146 3300039453 Bacteria 800
90 Ga0466968_0215712 3300044735 Bacteria 903
91 Ga0451576_0000143 3300045051 Bacteria 180834
92 Ga0495651_0052662 3300046462 Bacteria 3135
93 Ga0495608_0065708 3300046511 Bacteria 2375
94 Ga0495604_0030832 3300047317 Bacteria 4255
95 Ga0495674_0246544 3300047319 Bacteria 1471
96 Ga0495675_0462670 3300047444 Bacteria 732
97 Ga0495602_0396100 3300048088 Bacteria 986
98 Ga0496104_0056974 3300048907 Unclassified 3698
99 Ga0496104_0348688 3300048907 Unclassified 1393
100 Ga0496105_0114176 3300048908 Unclassified 2228
101 Ga0496105_0470017 3300048908 Bacteria 991
102 Ga0496106_0531993 3300048909 Bacteria 944
103 Ga0496110_0561869 3300048913 Bacteria 1037
104 Ga0496111_0213647 3300048914 Bacteria 1433
105 Ga0496112_0453278 3300048915 Bacteria 1220
106 Ga0496113_0639213 3300048916 Bacteria 851
107 Ga0501033_0015184 3300049570 Bacteria 5845
108 Ga0501034_0005902 3300049571 Bacteria 13290
109 Ga0501034_0029247 3300049571 Bacteria 5601
110 Ga0501040_0046671 3300049576 Bacteria 2957
111 Ga0501040_0685445 3300049576 Bacteria 741
112 Ga0501043_0126427 3300049579 Unclassified 2005
113 Ga0501046_0052163 3300049580 Bacteria 3224
114 Ga0501047_0005734 3300049581 Bacteria 11687
115 Ga0501047_0194154 3300049581 Bacteria 1893
116 Ga0501047_0633155 3300049581 Bacteria 890
117 Ga0501070_0002504 3300049586 Bacteria 16096
118 Ga0501070_0176459 3300049586 Bacteria 1759
119 Ga0501081_0627926 3300049743 Bacteria 805
120 Ga0501083_0314106 3300049744 Unclassified 1019
121 Ga0501035_0033631 3300049822 Bacteria 4661
122 Ga0501044_0044239 3300049823 Bacteria 4622
123 Ga0501044_0078551 3300049823 Bacteria 3344
124 Ga0501044_0141772 3300049823 Bacteria 2392
125 Ga0501044_0349375 3300049823 Unclassified 1399
126 Ga0501044_0727659 3300049823 Unclassified 876
127 nmdc:mga06r32_472382_c1 3300050510 Bacteria 1232
128 nmdc:mga08y16_1410382_c1 3300050511 Bacteria 659
129 Ga0495601_0583571 3300053077 Bacteria 718
130 Ga0495595_0065102 3300053084 Bacteria 1714
131 Ga0495595_0320667 3300053084 Bacteria 780
132 Ga0495619_0036000 3300053085 Bacteria 3222
133 Ga0495619_0094974 3300053085 Bacteria 2023
134 Ga0495619_0279221 3300053085 Unclassified 1157
135 Ga0501084_0013945 3300054114 Bacteria 6652
136 Ga0501084_0801584 3300054114 Bacteria 793
137 Ga0587080_036981 3300059503 Bacteria 875
138 Ga0587076_048193 3300059645 Bacteria 822
139 2673164969 2671180531 Bacteria 9045424
140 Ga0501035_0493882
141 Ga0058863_11803259
142 Ga0058861_11958931
143 Ga0058862_12736463
144 Ga0070662_100663758
145 Ga0070681_10273107
146 Ga0070681_10872707
147 Ga0070706_100325556
148 Ga0070665_100002119
149 Ga0068855_100260472
150 Ga0068854_100320484
151 Ga0068856_100473204
152 Ga0068852_100180902
153 Ga0068860_100041354
154 Ga0068860_101140973
155 Ga0075428_100003946
156 Ga0075428_100512922
157 Ga0105240_11266183
158 Ga0105248_10156667
159 Ga0105237_10029504
160 Ga0105238_10842604
161 Ga0105239_10139062
162 Ga0105239_10292932
163 Ga0157374_10433336
164 Ga0206352_11078464
165 Ga0206350_10353757
166 Ga0206350_10873940
167 Ga0213873_10000851
168 Ga0207684_10276711
169 Ga0207707_10461848
170 Ga0207671_10009760
171 Ga0207652_10219105
172 Ga0207694_10642582
173 Ga0207700_10236376
174 Ga0207644_10595315
175 Ga0207667_10135117
176 Ga0207702_10387825
177 Ga0207683_10837382
178 Ga0268266_10004109
179 Ga0268266_10507537
180 Ga0268264_10178206
181 Ga0268264_10940945
182 Ga0265319_1042365
183 Ga0265318_10139671
184 Ga0265338_10297821
185 Ga0265332_10018095
186 Ga0265325_10000983
187 Ga0265325_10043448
188 Ga0265339_10000169
189 Ga0265339_10179929
190 Ga0265331_10000111
191 Ga0265313_10001247
192 Ga0265314_10000082
193 Ga0265314_10005674
194 Ga0265314_10223208
195 Ga0265342_10008188
196 Ga0316574_0476846
197 Ga0373937_0422007
198 Ga0373925_0673412
199 Ga0395900_1322985
200 Ga0395905_0120811
201 Ga0436364_0657780
202 Ga0436364_0685097
203 Ga0436364_1199249
204 Ga0395901_0217961
205 Ga0436365_0375898
206 Ga0436365_0451999
207 Ga0436365_0460046
208 Ga0436365_1017444
209 Ga0436365_1195647
210 Ga0436365_1479675
211 Ga0436360_0033111
212 Ga0436360_0141892
213 Ga0436360_0220182
214 Ga0436360_0584304
215 Ga0436360_0921827
216 Ga0436360_1301184
217 Ga0436360_1351190
218 Ga0436361_0012120
219 Ga0436361_0216573
220 Ga0436361_0889124
221 Ga0436361_1172909
222 Ga0436363_0798649
223 Ga0436363_1612118
224 Ga0436362_0170323
225 Ga0436362_0234214
226 Ga0436362_0284143
227 Ga0436362_0693913
228 Ga0436362_1264146
229 Ga0466968_0215712
230 Ga0451576_0000143
231 Ga0495651_0052662
232 Ga0495608_0065708
233 Ga0495604_0030832
234 Ga0495674_0246544
235 Ga0495675_0462670
236 Ga0495602_0396100
237 Ga0496104_0056974
238 Ga0496104_0348688
239 Ga0496105_0114176
240 Ga0496105_0470017
241 Ga0496106_0531993
242 Ga0496110_0561869
243 Ga0496111_0213647
244 Ga0496112_0453278
245 Ga0496113_0639213
246 Ga0501033_0015184
247 Ga0501034_0005902
248 Ga0501034_0029247
249 Ga0501040_0046671
250 Ga0501040_0685445
251 Ga0501043_0126427
252 Ga0501046_0052163
253 Ga0501047_0005734
254 Ga0501047_0194154
255 Ga0501047_0633155
256 Ga0501070_0002504
257 Ga0501070_0176459
258 Ga0501081_0627926
259 Ga0501083_0314106
260 Ga0501035_0033631
261 Ga0501044_0044239
262 Ga0501044_0078551
263 Ga0501044_0141772
264 Ga0501044_0349375
265 Ga0501044_0727659
266 nmdc:mga06r32_472382_c1
267 nmdc:mga08y16_1410382_c1
268 Ga0495601_0583571
269 Ga0495595_0065102
270 Ga0495595_0320667
271 Ga0495619_0036000
272 Ga0495619_0094974
273 Ga0495619_0279221
274 Ga0501084_0013945
275 Ga0501084_0801584
276 Ga0587080_036981
277 Ga0587076_048193
278 2673164969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01844

HNH

HNH endonuclease

156

201

0.96

PF14279

HNH_5

HNH endonuclease

156

211

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ogc-assembly1.cif.gz_A crystal structure of the type ii-c cas9 enzyme from actinomyces naeslundii 0.8868 107 168
4oge-assembly1.cif.gz_A crystal structure of the type ii-c cas9 enzyme from actinomyces naeslundii 0.8864 107 168
7el1-assembly1.cif.gz_A structure of a protein from bacteria 0.8597 107 168
4h9d-assembly1.cif.gz_A crystal structure of mn-dependent gme hnh nicking endonuclease from geobacter metallireducens gs-15, northeast structural genomics consortium (nesg) target gmr87 0.851 108 169
7s4x-assembly1.cif.gz_A cas9:grna in complex with 18-20mm dna, 1 minute time-point, kinked active conformation 0.8492 106 168
ID Description Score Start End Superfamily
af_I1MTW9_33_119_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.9374 130 164 1.10.30.50
af_I1MTU7_87_181_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.9033 130 164 1.10.30.50
af_Q93518_12_136_2.60.120.290 Mainly Beta;Sandwich;Jelly Rolls;Spermadhesin, CUB domain 0.8466 41 55 2.60.120.290
4h9dC00 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.819 108 169 1.10.30.50
af_A0A0R0J215_612_725_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.7659 41 56 3.40.20.10
ID Description Score Start End GO Terms
AF-A0A6J4N4T4-F1-model_v4 HNH nuclease domain-containing protein 0.9847 107 168
AF-A0A2V7SNM6-F1-model_v4 HNH nuclease domain-containing protein 0.9816 106 168 GO:0003676
GO:0004519
GO:0008270
AF-A0A3L7Q9V7-F1-model_v4 HNH endonuclease 0.9676 9 208 GO:0004519
AF-A0A6L7ZFH0-F1-model_v4 deleted 0.9586 107 169
AF-A0A6M4IUY0-F1-model_v4 HNH endonuclease 0.9567 106 164 GO:0003676
GO:0004519
GO:0008270

Map