F177475

General Info

Members Datasets Scaffolds Average Seq Length
139 110 138 453

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0019879|Ga0496101_0019879_2844_4301
Length 485
Sequence MSVFMVKKSPKNSRRKARSQVGKAENDPLLGTWKKVLARKSDKAAVLDSRGRRLLRFREIEEWSRHYASEPAGLTSFQAGEIVAFQIGNHPHWPALFLACLRRGIAVLPIERTVSESERASALRTCGATGLITEPQKPIARFKKSPPNDWQGRPPVLLKLTSGTTAAARAVRFRSAQLVADAEHICDTMGISDDDLNFGVIPLSHSYGFSNLITPLLIRGVPMVVSSDRMPRAVLDDLAWTGATVFPGMPLFYQAFVEMPDVPALPKLRLCISAGAPLKRVVARAFHQRFGQPIHSFYGASECGGICYDRHALNEDEGFVGQPMGGVQLRPISLTKSSSQVRIRSAAVGDGYFPEPDGAKLGNGVFVPDDLLAINREGVRIVGRVSDVINVAGKKVNPAEVEAHLLSHQAVRQAVVFGRSSPLRNQEVVACVVASRGTEEADLLDFCRTLLSGWQVPKRIYLLEALPANERGKISRRELAQQFAT

Samples

Sample ID Description Type Environment
1 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
89 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
106 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
107 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
108 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
109 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
110 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.32
Nodule 0
Rhizoplane 2.16
Rhizosphere 84.89
Stem 0
Stem Tuber 0
Unclassified 8.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10015268 3300003323 Bacteria 37011
2 Ga0070658_10015699 3300005327 Bacteria 6057
3 Ga0070683_100000042 3300005329 Bacteria 115507
4 Ga0070670_100000311 3300005331 Bacteria 41777
5 Ga0070670_100086044 3300005331 Unclassified 2701
6 Ga0070670_100207785 3300005331 Unclassified 1702
7 Ga0070680_100003549 3300005336 Bacteria 11633
8 Ga0068868_100000318 3300005338 Bacteria 32344
9 Ga0070687_100003156 3300005343 Bacteria 6355
10 Ga0070668_100075768 3300005347 Unclassified 2627
11 Ga0070675_100000004 3300005354 Bacteria 361974
12 Ga0070671_100027082 3300005355 Bacteria 4716
13 Ga0070671_100056009 3300005355 Bacteria 3280
14 Ga0070673_100093042 3300005364 Unclassified 2468
15 Ga0070667_100017167 3300005367 Bacteria 5995
16 Ga0070709_10128474 3300005434 Unclassified 1727
17 Ga0070714_100069801 3300005435 Bacteria 3036
18 Ga0070701_10000304 3300005438 Bacteria 16090
19 Ga0070700_100000187 3300005441 Bacteria 35371
20 Ga0070708_100088285 3300005445 Bacteria 2819
21 Ga0070706_100073565 3300005467 Bacteria 3163
22 Ga0070707_100016033 3300005468 Bacteria 7029
23 Ga0070707_100115891 3300005468 Bacteria 2600
24 Ga0070707_100121777 3300005468 Unclassified 2533
25 Ga0070698_100013128 3300005471 Bacteria 8765
26 Ga0070684_100000303 3300005535 Bacteria 34159
27 Ga0070697_100225983 3300005536 Bacteria 1596
28 Ga0070665_100028247 3300005548 Bacteria 5650
29 Ga0068855_100013265 3300005563 Bacteria 9936
30 Ga0068857_100008384 3300005577 Bacteria 8932
31 Ga0068856_100000598 3300005614 Bacteria 39437
32 Ga0070702_100001405 3300005615 Bacteria 9832
33 Ga0068870_10018460 3300005840 Bacteria 3369
34 Ga0068863_100198720 3300005841 Unclassified 1928
35 Ga0081539_10001382 3300005985 Bacteria 41998
36 Ga0070712_100236221 3300006175 Unclassified 1454
37 Ga0075362_10018507 3300006177 Bacteria 2884
38 Ga0097621_100030869 3300006237 Bacteria 4246
39 Ga0097621_100031372 3300006237 Bacteria 4217
40 Ga0068871_100007357 3300006358 Bacteria 7856
41 Ga0075428_100022407 3300006844 Bacteria 6995
42 Ga0111539_10000004 3300009094 Bacteria 751278
43 Ga0105245_10000035 3300009098 Bacteria 147165
44 Ga0105245_10005101 3300009098 Bacteria 11548
45 Ga0105242_10000933 3300009176 Bacteria 22770
46 Ga0105238_10000008 3300009551 Bacteria 307196
47 Ga0157369_10000146 3300013105 Bacteria 100176
48 Ga0157374_10000008 3300013296 Bacteria 588863
49 Ga0157374_10005085 3300013296 Bacteria 11028
50 Ga0157378_10001713 3300013297 Bacteria 19722
51 Ga0157378_10002039 3300013297 Bacteria 18100
52 Ga0157378_10010050 3300013297 Bacteria 8247
53 Ga0157375_10000164 3300013308 Bacteria 62161
54 Ga0157375_10003294 3300013308 Bacteria 13982
55 Ga0157375_10010340 3300013308 Bacteria 8214
56 Ga0163163_10082156 3300014325 Bacteria 3225
57 Ga0157377_10000042 3300014745 Bacteria 106623
58 Ga0157377_10000146 3300014745 Bacteria 44456
59 Ga0157376_10000002 3300014969 Bacteria 684532
60 Ga0213872_10000762 3300021361 Bacteria 23678
61 Ga0213874_10003861 3300021377 Unclassified 3367
62 Ga0213876_10000429 3300021384 Bacteria 34730
63 Ga0213876_10003354 3300021384 Bacteria 9166
64 Ga0207705_10123906 3300025909 Bacteria 1919
65 Ga0207660_10004998 3300025917 Bacteria 8646
66 Ga0207662_10007220 3300025918 Bacteria 6043
67 Ga0207646_10050467 3300025922 Bacteria 3723
68 Ga0207694_10000001 3300025924 Bacteria 4078485
69 Ga0207650_10000071 3300025925 Bacteria 137924
70 Ga0207650_10009806 3300025925 Bacteria 6548
71 Ga0207650_10011774 3300025925 Bacteria 6032
72 Ga0207659_10000002 3300025926 Bacteria 619441
73 Ga0207687_10000009 3300025927 Bacteria 443946
74 Ga0207687_10002854 3300025927 Bacteria 11734
75 Ga0207664_10216310 3300025929 Unclassified 1660
76 Ga0207689_10020524 3300025942 Bacteria 5559
77 Ga0207661_10000002 3300025944 Bacteria 816104
78 Ga0207667_10008712 3300025949 Bacteria 12024
79 Ga0207658_10140388 3300025986 Unclassified 1954
80 Ga0207677_10000067 3300026023 Bacteria 87739
81 Ga0207708_10000035 3300026075 Bacteria 140227
82 Ga0207702_10000639 3300026078 Bacteria 38339
83 Ga0207674_10013876 3300026116 Bacteria 8913
84 Ga0207428_10000006 3300027907 Bacteria 491716
85 Ga0268266_10044118 3300028379 Bacteria 3811
86 Ga0307511_10000789 3300030521 Bacteria 33817
87 Ga0373945_0046357 3300035116 Unclassified 1586
88 Ga0373943_0023188 3300035170 Unclassified 2884
89 Ga0373943_0025461 3300035170 Bacteria 2766
90 Ga0373947_0014888 3300035725 Unclassified 4464
91 Ga0373937_0126027 3300036401 Bacteria 2389
92 Ga0395899_0000009 3300037312 Bacteria 538632
93 Ga0395898_0000050 3300037466 Bacteria 283059
94 Ga0395905_0107297 3300037471 Bacteria 2622
95 Ga0436365_0040027 3300039437 Bacteria 51300
96 Ga0436365_0298762 3300039437 Bacteria 35550
97 Ga0436365_0310738 3300039437 Bacteria 37617
98 Ga0436365_0483088 3300039437 Bacteria 7740
99 Ga0436365_1314960 3300039437 Bacteria 2877
100 Ga0436360_0404690 3300039438 Unclassified 1966
101 Ga0436360_0980144 3300039438 Unclassified 1893
102 Ga0436360_1073315 3300039438 Bacteria 5210
103 Ga0436361_0249186 3300039447 Bacteria 5136
104 Ga0436361_0436057 3300039447 Bacteria 2328
105 Ga0436361_0529062 3300039447 Bacteria 8457
106 Ga0436361_0548972 3300039447 Bacteria 16301
107 Ga0436361_0877328 3300039447 Unclassified 1944
108 Ga0436363_0475630 3300039450 Bacteria 27763
109 Ga0436362_0473172 3300039453 Bacteria 5394
110 Ga0466965_0031192 3300044683 Bacteria 2599
111 Ga0466971_0000020 3300044719 Bacteria 78865
112 Ga0451576_0021313 3300045051 Bacteria 7044
113 Ga0495620_0009777 3300046515 Bacteria 5087
114 Ga0495652_0007189 3300046529 Bacteria 10277
115 Ga0495675_0068605 3300047444 Bacteria 2240
116 Ga0495684_0042233 3300047471 Bacteria 3493
117 Ga0496101_0019879 3300048904 Bacteria 4592
118 Ga0496112_0091210 3300048915 Bacteria 3016
119 Ga0496113_0029482 3300048916 Bacteria 3964
120 Ga0501031_0004734 3300049568 Bacteria 8831
121 Ga0501033_0000024 3300049570 Bacteria 175859
122 Ga0501036_0022168 3300049572 Bacteria 5343
123 Ga0501037_0000116 3300049573 Bacteria 74682
124 Ga0501038_0000634 3300049574 Bacteria 31252
125 Ga0501039_0068631 3300049575 Bacteria 2752
126 Ga0501043_0000342 3300049579 Bacteria 42181
127 Ga0501043_0020412 3300049579 Bacteria 5196
128 Ga0501047_0001211 3300049581 Bacteria 25605
129 Ga0501035_0001096 3300049822 Bacteria 28396
130 Ga0501044_0002007 3300049823 Bacteria 23470
131 nmdc:mga03683_63_c1 3300050489 Bacteria 41164
132 nmdc:mga08y16_5_c1 3300050511 Bacteria 751284
133 Ga0495655_0000955 3300053083 Bacteria 4485
134 Ga0500555_000133 3300053103 Bacteria 35259
135 Ga0500556_0000010 3300053104 Bacteria 258288
136 Ga0500616_0003907 3300053153 Bacteria 10960
137 Ga0500645_023564 3300053730 Unclassified 1886
138 Ga0466962_0000017 3300061719 Bacteria 97361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0529062 Ga0436361_0529062_2674_3852 344
2 3300006844 Ga0075428_100022407 Ga0075428_1000224073 358
3 3300005336 Ga0070680_100003549 Ga0070680_1000035492 363
4 3300025917 Ga0207660_10004998 Ga0207660_100049985 363
5 3300037471 Ga0395905_0107297 Ga0395905_0107297_32_1249 372
6 3300005354 Ga0070675_100000004 Ga0070675_100000004192 380
7 3300005840 Ga0068870_10018460 Ga0068870_100184604 380
8 3300025926 Ga0207659_10000002 Ga0207659_10000002279 380
9 3300009176 Ga0105242_10000933 Ga0105242_1000093318 388
10 3300005468 Ga0070707_100121777 Ga0070707_1001217772 397
11 3300005577 Ga0068857_100008384 Ga0068857_1000083844 400
12 3300026116 Ga0207674_10013876 Ga0207674_100138767 400
13 3300005615 Ga0070702_100001405 Ga0070702_1000014056 401
14 3300005441 Ga0070700_100000187 Ga0070700_10000018717 402
15 3300026075 Ga0207708_10000035 Ga0207708_1000003586 402
16 3300046515 Ga0495620_0009777 Ga0495620_0009777_2580_3875 403
17 3300014745 Ga0157377_10000146 Ga0157377_1000014617 404
18 3300025942 Ga0207689_10020524 Ga0207689_100205246 404
19 3300025949 Ga0207667_10008712 Ga0207667_100087126 405
20 3300035170 Ga0373943_0023188 Ga0373943_0023188_674_1990 406
21 3300035725 Ga0373947_0014888 Ga0373947_0014888_2831_4147 406
22 iso_pu_bacteria 2786546548 2787509077 408
23 3300005338 Ga0068868_100000318 Ga0068868_10000031810 410
24 3300005343 Ga0070687_100003156 Ga0070687_1000031564 410
25 3300025918 Ga0207662_10007220 Ga0207662_100072203 410
26 3300026023 Ga0207677_10000067 Ga0207677_1000006726 410
27 3300039437 Ga0436365_1314960 Ga0436365_1314960_483_1832 411
28 3300049570 Ga0501033_0000024 Ga0501033_0000024_149664_151097 413
29 3300049574 Ga0501038_0000634 Ga0501038_0000634_4170_5603 413
30 3300005355 Ga0070671_100056009 Ga0070671_1000560092 415
31 3300005445 Ga0070708_100088285 Ga0070708_1000882853 416
32 3300009094 Ga0111539_10000004 Ga0111539_10000004127 416
33 3300009098 Ga0105245_10005101 Ga0105245_100051011 416
34 3300013105 Ga0157369_10000146 Ga0157369_1000014697 416
35 3300025927 Ga0207687_10002854 Ga0207687_100028541 416
36 3300027907 Ga0207428_10000006 Ga0207428_10000006127 416
37 3300044683 Ga0466965_0031192 Ga0466965_0031192_912_2339 416
38 3300044719 Ga0466971_0000020 Ga0466971_0000020_25437_26864 416
39 3300050511 nmdc:mga08y16_5_c1 nmdc:mga08y16_5_c1_634748_636091 416
40 3300061719 Ga0466962_0000017 Ga0466962_0000017_86394_87821 416
41 3300005329 Ga0070683_100000042 Ga0070683_100000042100 417
42 3300005331 Ga0070670_100000311 Ga0070670_10000031134 417
43 3300005331 Ga0070670_100086044 Ga0070670_1000860442 417
44 3300005535 Ga0070684_100000303 Ga0070684_10000030325 417
45 3300009098 Ga0105245_10000035 Ga0105245_10000035117 417
46 3300013308 Ga0157375_10003294 Ga0157375_100032949 417
47 3300014969 Ga0157376_10000002 Ga0157376_10000002483 417
48 3300021384 Ga0213876_10000429 Ga0213876_1000042925 417
49 3300025925 Ga0207650_10000071 Ga0207650_10000071120 417
50 3300025925 Ga0207650_10009806 Ga0207650_100098062 417
51 3300025927 Ga0207687_10000009 Ga0207687_10000009376 417
52 3300025944 Ga0207661_10000002 Ga0207661_10000002679 417
53 3300036401 Ga0373937_0126027 Ga0373937_0126027_615_2012 417
54 3300039437 Ga0436365_0298762 Ga0436365_0298762_23742_25079 417
55 3300039453 Ga0436362_0473172 Ga0436362_0473172_1124_2461 417
56 3300046529 Ga0495652_0007189 Ga0495652_0007189_7988_9385 417
57 3300047444 Ga0495675_0068605 Ga0495675_0068605_343_1740 417
58 3300047471 Ga0495684_0042233 Ga0495684_0042233_353_1750 417
59 3300053083 Ga0495655_0000955 Ga0495655_0000955_2964_4307 417
60 3300039437 Ga0436365_0483088 Ga0436365_0483088_4312_5655 418
61 3300030521 Ga0307511_10000789 Ga0307511_1000078927 419
62 3300005327 Ga0070658_10015699 Ga0070658_100156998 420
63 3300005438 Ga0070701_10000304 Ga0070701_100003043 420
64 3300013297 Ga0157378_10001713 Ga0157378_1000171315 420
65 3300013297 Ga0157378_10002039 Ga0157378_1000203914 420
66 3300013308 Ga0157375_10000164 Ga0157375_1000016434 420
67 3300014325 Ga0163163_10082156 Ga0163163_100821561 420
68 3300025909 Ga0207705_10123906 Ga0207705_101239062 420
69 3300035170 Ga0373943_0025461 Ga0373943_0025461_816_2165 420
70 3300009551 Ga0105238_10000008 Ga0105238_10000008145 421
71 3300013296 Ga0157374_10000008 Ga0157374_1000000830 421
72 3300014745 Ga0157377_10000042 Ga0157377_1000004230 421
73 3300025924 Ga0207694_10000001 Ga0207694_100000013518 421
74 3300005985 Ga0081539_10001382 Ga0081539_100013829 424
75 3300053153 Ga0500616_0003907 Ga0500616_0003907_8577_10031 424
76 3300005331 Ga0070670_100207785 Ga0070670_1002077851 427
77 3300005355 Ga0070671_100027082 Ga0070671_1000270823 427
78 3300005364 Ga0070673_100093042 Ga0070673_1000930422 427
79 3300005367 Ga0070667_100017167 Ga0070667_1000171673 427
80 3300005548 Ga0070665_100028247 Ga0070665_1000282476 427
81 3300006237 Ga0097621_100030869 Ga0097621_1000308693 427
82 3300013296 Ga0157374_10005085 Ga0157374_100050859 427
83 3300013308 Ga0157375_10010340 Ga0157375_100103404 427
84 3300025925 Ga0207650_10011774 Ga0207650_100117741 427
85 3300025986 Ga0207658_10140388 Ga0207658_101403882 427
86 3300035116 Ga0373945_0046357 Ga0373945_0046357_110_1489 427
87 3300006237 Ga0097621_100031372 Ga0097621_1000313723 428
88 3300006358 Ga0068871_100007357 Ga0068871_1000073574 428
89 3300013297 Ga0157378_10010050 Ga0157378_100100504 428
90 3300048904 Ga0496101_0019879 Ga0496101_0019879_2844_4301 428
91 3300048915 Ga0496112_0091210 Ga0496112_0091210_726_2126 428
92 3300048916 Ga0496113_0029482 Ga0496113_0029482_554_1954 428
93 3300005347 Ga0070668_100075768 Ga0070668_1000757683 429
94 3300045051 Ga0451576_0021313 Ga0451576_0021313_4069_5565 429
95 3300039447 Ga0436361_0249186 Ga0436361_0249186_85_1458 430
96 3300053730 Ga0500645_023564 Ga0500645_023564_411_1826 430
97 3300005434 Ga0070709_10128474 Ga0070709_101284742 431
98 3300005435 Ga0070714_100069801 Ga0070714_1000698012 431
99 3300006175 Ga0070712_100236221 Ga0070712_1002362211 431
100 3300025929 Ga0207664_10216310 Ga0207664_102163101 431
101 3300039437 Ga0436365_0310738 Ga0436365_0310738_21283_22659 431
102 3300039438 Ga0436360_0404690 Ga0436360_0404690_31_1407 431
103 3300039438 Ga0436360_0980144 Ga0436360_0980144_238_1614 431
104 3300039438 Ga0436360_1073315 Ga0436360_1073315_1343_2719 431
105 3300039447 Ga0436361_0436057 Ga0436361_0436057_472_1848 431
106 3300039447 Ga0436361_0877328 Ga0436361_0877328_182_1600 431
107 3300005467 Ga0070706_100073565 Ga0070706_1000735654 432
108 3300005468 Ga0070707_100115891 Ga0070707_1001158912 432
109 3300005471 Ga0070698_100013128 Ga0070698_1000131281 432
110 3300005536 Ga0070697_100225983 Ga0070697_1002259831 432
111 3300021377 Ga0213874_10003861 Ga0213874_100038612 432
112 3300021384 Ga0213876_10003354 Ga0213876_100033543 432
113 3300039437 Ga0436365_0040027 Ga0436365_0040027_28110_29498 432
114 3300039447 Ga0436361_0548972 Ga0436361_0548972_2577_4010 432
115 3300039450 Ga0436363_0475630 Ga0436363_0475630_5763_7142 432
116 3300049568 Ga0501031_0004734 Ga0501031_0004734_7015_8436 432
117 3300049572 Ga0501036_0022168 Ga0501036_0022168_2651_4072 432
118 3300049575 Ga0501039_0068631 Ga0501039_0068631_1110_2531 432
119 3300049579 Ga0501043_0020412 Ga0501043_0020412_90_1511 432
120 3300049581 Ga0501047_0001211 Ga0501047_0001211_23257_24678 432
121 3300049822 Ga0501035_0001096 Ga0501035_0001096_23279_24700 432
122 3300005563 Ga0068855_100013265 Ga0068855_1000132656 433
123 3300005841 Ga0068863_100198720 Ga0068863_1001987202 433
124 3300028379 Ga0268266_10044118 Ga0268266_100441182 433
125 3300049573 Ga0501037_0000116 Ga0501037_0000116_71_1498 434
126 3300049823 Ga0501044_0002007 Ga0501044_0002007_19050_20477 434
127 3300006177 Ga0075362_10018507 Ga0075362_100185073 435
128 3300021361 Ga0213872_10000762 Ga0213872_1000076220 435
129 3300050489 nmdc:mga03683_63_c1 nmdc:mga03683_63_c1_32444_33841 435
130 3300053103 Ga0500555_000133 Ga0500555_000133_19280_20677 435
131 3300053104 Ga0500556_0000010 Ga0500556_0000010_34941_36338 435
132 3300005468 Ga0070707_100016033 Ga0070707_1000160334 436
133 3300025922 Ga0207646_10050467 Ga0207646_100504675 436
134 3300037312 Ga0395899_0000009 Ga0395899_0000009_175498_176904 436
135 3300037466 Ga0395898_0000050 Ga0395898_0000050_114306_115748 439
136 3300049579 Ga0501043_0000342 Ga0501043_0000342_34779_36224 440
137 3300003323 rootH1_10015268 rootH1_1001526821 442
138 3300005614 Ga0068856_100000598 Ga0068856_1000005987 442
139 3300026078 Ga0207702_10000639 Ga0207702_100006394 442

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

400

473

0.96

PF00501

AMP-binding

AMP-binding enzyme

134

333

0.88

PF00501

AMP-binding

AMP-binding enzyme

33

149

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8aff-assembly1.cif.gz_A wild type oxalyl-coa synthetase pcs60p 0.8674 20 431
8atd-assembly1.cif.gz_F wild type hexamer oxalyl-coa synthetase (ocs) 0.8563 16 332
8afg-assembly1.cif.gz_B k352d oxalyl-coa synthetase pcs60p 0.849 16 338
5zrn-assembly1.cif.gz_A inhibitor bound crystal structure of n-terminal domain of facl13 from mycobacterium tuberculosis 0.8458 1 332
4u5y-assembly1.cif.gz_D crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica 0.8421 345 437
ID Description Score Start End Superfamily
af_Q9XV68_424_526_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9503 336 430 3.30.300.30
af_P31552_422_517_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9485 336 427 3.30.300.30
af_K7VHQ0_441_545_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.947 335 430 3.30.300.30
af_P96843_409_507_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9445 335 430 3.30.300.30
af_P69451_456_557_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9444 335 430 3.30.300.30
ID Description Score Start End GO Terms
AF-A0A838FUR1-F1-model_v4 AMP-binding protein 0.9221 1 166
AF-A0A7W1XUZ9-F1-model_v4 Non-ribosomal peptide synthetase 0.9158 346 425 GO:0003824
GO:0031177
AF-A0A838FUR1-F1-model_v4 AMP-binding protein 0.9114 1 166
AF-A0A2S8MHT3-F1-model_v4 deleted 0.8995 314 431
AF-C2YZC3-F1-model_v4 deleted 0.8993 317 434

Feature Viewer

pLDDT pTM Quality
84.92 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map