F177229

General Info

Members Datasets Scaffolds Average Seq Length
139 103 278 121

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0766673|Ga0466957_0766673_218_619
Length 123
Sequence VIPSLTYNLVVVGPADEERVDRVFSALGDATRRDILRRAAHGEHSVSALARQYPVSFAAVQKHVAVLERAGLVVKRRHGREHLVSTDVAILEAQWRDRLDRFGEVLAELPPNEHRDQEEAQDG

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
5 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
6 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
9 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
10 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
11 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
20 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
31 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
32 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
33 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
34 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
35 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
36 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
37 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
41 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
46 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
47 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
48 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
49 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
50 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
51 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
52 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
53 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
54 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
62 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
63 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
64 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
65 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
66 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
67 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
68 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
69 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
70 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
71 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
72 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
73 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
79 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
80 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
81 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
82 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
83 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
84 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
85 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
86 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
87 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
88 2643221566 Microbacterium sp. Root166 Isolate Unclassified
89 2643221597 Microbacterium sp. Root180 Isolate Unclassified
90 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
91 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
92 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
93 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
94 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
95 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
96 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
97 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
98 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
99 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
100 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
101 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
102 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
103 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.61
Metatranscriptomes 2.88
Isolates 11.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 12.95
Nodule 0
Rhizoplane 6.47
Rhizosphere 58.27
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0766673 3300044842 Bacteria 684
2 Ga0006562J51391_1109232 3300003578 Bacteria 15090
3 Ga0006562J51391_1109233 3300003578 Bacteria 12562
4 Ga0070658_10012979 3300005327 Bacteria 6687
5 Ga0070686_100663045 3300005544 Unclassified 828
6 Ga0068856_100006820 3300005614 Bacteria 11173
7 Ga0068852_101018255 3300005616 Bacteria 847
8 Ga0075365_10011894 3300006038 Bacteria 5139
9 Ga0075369_10059210 3300006186 Bacteria 1669
10 Ga0075370_10061854 3300006353 Bacteria 2133
11 Ga0105240_10198853 3300009093 Bacteria 2351
12 Ga0105240_10808271 3300009093 Bacteria 1015
13 Ga0114129_10540971 3300009147 Unclassified 1516
14 Ga0105243_10046848 3300009148 Bacteria 3402
15 Ga0157370_11154439 3300013104 Bacteria 699
16 Ga0157369_10885164 3300013105 Bacteria 916
17 Ga0157369_12043794 3300013105 Bacteria 581
18 Ga0171462_1005 3300013250 Bacteria 598379
19 Ga0163163_12844168 3300014325 Bacteria 540
20 Ga0206353_10552641 3300020082 Bacteria 765
21 Ga0154015_1247160 3300020610 Bacteria 1061
22 Ga0213876_10001010 3300021384 Bacteria 18247
23 Ga0207697_10239784 3300025315 Bacteria 801
24 Ga0207655_1001427 3300025728 Bacteria 22155
25 Ga0207655_1007049 3300025728 Bacteria 7359
26 Ga0207705_10009750 3300025909 Bacteria 6987
27 Ga0207695_10162184 3300025913 Bacteria 2166
28 Ga0207671_10396630 3300025914 Bacteria 1097
29 Ga0207694_10533925 3300025924 Bacteria 984
30 Ga0207709_10020635 3300025935 Bacteria 3720
31 Ga0207709_10177803 3300025935 Bacteria 1500
32 Ga0207640_10629655 3300025981 Bacteria 912
33 Ga0207702_10033697 3300026078 Bacteria 4279
34 Ga0207698_10421388 3300026142 Bacteria 1281
35 Ga0265339_10034225 3300031249 Bacteria 2856
36 Ga0307408_101961590 3300031548 Bacteria 562
37 Ga0307405_10066843 3300031731 Bacteria 2294
38 Ga0307405_10737934 3300031731 Bacteria 819
39 Ga0307413_10248481 3300031824 Bacteria 1318
40 Ga0307413_10811742 3300031824 Bacteria 787
41 Ga0307413_11339236 3300031824 Bacteria 628
42 Ga0307410_11119534 3300031852 Bacteria 683
43 Ga0307410_11505055 3300031852 Bacteria 593
44 Ga0307406_10000674 3300031901 Bacteria 19291
45 Ga0307406_10209401 3300031901 Bacteria 1441
46 Ga0307406_10303611 3300031901 Bacteria 1227
47 Ga0307406_10312250 3300031901 Bacteria 1212
48 Ga0307407_10809872 3300031903 Bacteria 713
49 Ga0307412_10408058 3300031911 Bacteria 1108
50 Ga0307412_10456547 3300031911 Bacteria 1054
51 Ga0307409_100365778 3300031995 Bacteria 1366
52 Ga0307409_101233446 3300031995 Bacteria 772
53 Ga0307409_101582515 3300031995 Bacteria 683
54 Ga0307409_101685309 3300031995 Bacteria 663
55 Ga0307409_101804342 3300031995 Bacteria 641
56 Ga0307416_100231672 3300032002 Bacteria 1781
57 Ga0307416_102678840 3300032002 Bacteria 595
58 Ga0307416_103891179 3300032002 Bacteria 500
59 Ga0307414_10670787 3300032004 Bacteria 936
60 Ga0307414_11146087 3300032004 Bacteria 719
61 Ga0307414_11255858 3300032004 Bacteria 687
62 Ga0307415_100070549 3300032126 Bacteria 2454
63 Ga0307415_100276286 3300032126 Bacteria 1379
64 Ga0395900_0016853 3300037418 Bacteria 7455
65 Ga0395898_0103954 3300037466 Bacteria 2724
66 Ga0395905_0271238 3300037471 Bacteria 1583
67 Ga0436365_0869324 3300039437 Bacteria 2800
68 Ga0436365_1421393 3300039437 Bacteria 22598
69 Ga0451789_0137393 3300041443 Bacteria 815
70 Ga0451797_1538697 3300041453 Bacteria 1024
71 Ga0451806_286149 3300041462 Bacteria 622
72 Ga0451835_0803186 3300041492 Bacteria 501
73 Ga0451843_1621016 3300041509 Bacteria 896
74 Ga0451853_2010233 3300041512 Bacteria 1205
75 Ga0466965_0193265 3300044683 Bacteria 1077
76 Ga0466964_0145445 3300044706 Bacteria 1094
77 Ga0466968_0091852 3300044735 Bacteria 1346
78 Ga0466970_0677287 3300044765 Bacteria 601
79 Ga0466960_0430711 3300044901 Bacteria 764
80 Ga0466960_0521470 3300044901 Bacteria 698
81 Ga0466959_0348528 3300045049 Bacteria 1010
82 Ga0466958_0334698 3300045836 Bacteria 974
83 Ga0466958_0557514 3300045836 Bacteria 745
84 Ga0466967_2055522 3300045976 Bacteria 568
85 Ga0495628_1058371 3300046516 Bacteria 556
86 Ga0496101_1424665 3300048904 Bacteria 540
87 Ga0496103_0318570 3300048906 Bacteria 1000
88 Ga0496104_0800787 3300048907 Bacteria 848
89 Ga0496105_0056459 3300048908 Bacteria 3241
90 Ga0496109_0153145 3300048912 Bacteria 2159
91 Ga0496113_1392880 3300048916 Bacteria 543
92 Ga0496117_0003509 3300048920 Bacteria 18166
93 Ga0496118_0009783 3300048921 Bacteria 9612
94 Ga0496118_0043196 3300048921 Bacteria 3547
95 Ga0496119_0000449 3300048922 Bacteria 56334
96 Ga0496119_0001937 3300048922 Bacteria 23590
97 Ga0496119_0010867 3300048922 Bacteria 7608
98 Ga0496120_0008165 3300048923 Bacteria 7676
99 Ga0496120_0053997 3300048923 Bacteria 2280
100 Ga0496122_0000270 3300048925 Bacteria 116104
101 Ga0496123_0000036 3300048926 Bacteria 265722
102 Ga0496124_0042555 3300048927 Bacteria 3910
103 Ga0496125_0000755 3300048928 Bacteria 53026
104 Ga0496126_0033404 3300048929 Bacteria 4840
105 Ga0501041_0509425 3300049577 Bacteria 766
106 Ga0501047_0155106 3300049581 Bacteria 2164
107 nmdc:mga00v17_463042_c1 3300050491 Bacteria 823
108 nmdc:mga00v17_487940_c1 3300050491 Bacteria 799
109 nmdc:mga0yw44_390880_c1 3300050492 Bacteria 940
110 nmdc:mga06z11_144554_c1 3300050494 Bacteria 1347
111 nmdc:mga07m45_210813_c1 3300050496 Bacteria 1130
112 nmdc:mga0rr50_127112_c1 3300050513 Bacteria 2037
113 nmdc:mga0a205_7143_c1 3300050515 Bacteria 10094
114 nmdc:mga0sz30_146624_c1 3300050516 Bacteria 1043
115 Ga0500559_0000286 3300053136 Bacteria 39086
116 Ga0500559_0102204 3300053136 Bacteria 1321
117 Ga0500559_0277840 3300053136 Bacteria 788
118 Ga0500573_0003338 3300053140 Bacteria 8290
119 Ga0500573_0011742 3300053140 Bacteria 4909
120 Ga0500573_0035627 3300053140 Bacteria 2871
121 Ga0500573_0205600 3300053140 Bacteria 1042
122 Ga0500573_0265541 3300053140 Bacteria 876
123 Ga0500620_033151 3300053155 Bacteria 1649
124 2643847426 2643221566 Bacteria 3460379
125 2643997412 2643221597 Bacteria 3347721
126 2774401234 2773857763 Bacteria 4180068
127 2809225757 2808606447 Bacteria 3572005
128 2812325263 2811994872 Bacteria 4121241
129 2821271918 2821268502 Bacteria 3750023
130 2833712968 2833709550 Bacteria 4008291
131 2852635370 2852632344 Bacteria 3463163
132 2910810884 2910809715 Bacteria 4982797
133 2919054269 2919051321 Bacteria 4210889
134 2919542689 2919538618 Bacteria 4677069
135 2928093306 2928090899 Bacteria 3158267
136 2932429773 2932426870 Bacteria 4547726
137 2964328334 2964326757 Bacteria 3290868
138 2984583048 2984580707 Bacteria 3351387
139 8045833289 8045830549 Bacteria 4444727
140 Ga0466957_0766673
141 Ga0006562J51391_1109232
142 Ga0006562J51391_1109233
143 Ga0070658_10012979
144 Ga0070686_100663045
145 Ga0068856_100006820
146 Ga0068852_101018255
147 Ga0075365_10011894
148 Ga0075369_10059210
149 Ga0075370_10061854
150 Ga0105240_10198853
151 Ga0105240_10808271
152 Ga0114129_10540971
153 Ga0105243_10046848
154 Ga0157370_11154439
155 Ga0157369_10885164
156 Ga0157369_12043794
157 Ga0171462_1005
158 Ga0163163_12844168
159 Ga0206353_10552641
160 Ga0154015_1247160
161 Ga0213876_10001010
162 Ga0207697_10239784
163 Ga0207655_1001427
164 Ga0207655_1007049
165 Ga0207705_10009750
166 Ga0207695_10162184
167 Ga0207671_10396630
168 Ga0207694_10533925
169 Ga0207709_10020635
170 Ga0207709_10177803
171 Ga0207640_10629655
172 Ga0207702_10033697
173 Ga0207698_10421388
174 Ga0265339_10034225
175 Ga0307408_101961590
176 Ga0307405_10066843
177 Ga0307405_10737934
178 Ga0307413_10248481
179 Ga0307413_10811742
180 Ga0307413_11339236
181 Ga0307410_11119534
182 Ga0307410_11505055
183 Ga0307406_10000674
184 Ga0307406_10209401
185 Ga0307406_10303611
186 Ga0307406_10312250
187 Ga0307407_10809872
188 Ga0307412_10408058
189 Ga0307412_10456547
190 Ga0307409_100365778
191 Ga0307409_101233446
192 Ga0307409_101582515
193 Ga0307409_101685309
194 Ga0307409_101804342
195 Ga0307416_100231672
196 Ga0307416_102678840
197 Ga0307416_103891179
198 Ga0307414_10670787
199 Ga0307414_11146087
200 Ga0307414_11255858
201 Ga0307415_100070549
202 Ga0307415_100276286
203 Ga0395900_0016853
204 Ga0395898_0103954
205 Ga0395905_0271238
206 Ga0436365_0869324
207 Ga0436365_1421393
208 Ga0451789_0137393
209 Ga0451797_1538697
210 Ga0451806_286149
211 Ga0451835_0803186
212 Ga0451843_1621016
213 Ga0451853_2010233
214 Ga0466965_0193265
215 Ga0466964_0145445
216 Ga0466968_0091852
217 Ga0466970_0677287
218 Ga0466960_0430711
219 Ga0466960_0521470
220 Ga0466959_0348528
221 Ga0466958_0334698
222 Ga0466958_0557514
223 Ga0466967_2055522
224 Ga0495628_1058371
225 Ga0496101_1424665
226 Ga0496103_0318570
227 Ga0496104_0800787
228 Ga0496105_0056459
229 Ga0496109_0153145
230 Ga0496113_1392880
231 Ga0496117_0003509
232 Ga0496118_0009783
233 Ga0496118_0043196
234 Ga0496119_0000449
235 Ga0496119_0001937
236 Ga0496119_0010867
237 Ga0496120_0008165
238 Ga0496120_0053997
239 Ga0496122_0000270
240 Ga0496123_0000036
241 Ga0496124_0042555
242 Ga0496125_0000755
243 Ga0496126_0033404
244 Ga0501041_0509425
245 Ga0501047_0155106
246 nmdc:mga00v17_463042_c1
247 nmdc:mga00v17_487940_c1
248 nmdc:mga0yw44_390880_c1
249 nmdc:mga06z11_144554_c1
250 nmdc:mga07m45_210813_c1
251 nmdc:mga0rr50_127112_c1
252 nmdc:mga0a205_7143_c1
253 nmdc:mga0sz30_146624_c1
254 Ga0500559_0000286
255 Ga0500559_0102204
256 Ga0500559_0277840
257 Ga0500573_0003338
258 Ga0500573_0011742
259 Ga0500573_0035627
260 Ga0500573_0205600
261 Ga0500573_0265541
262 Ga0500620_033151
263 2643847426
264 2643997412
265 2774401234
266 2809225757
267 2812325263
268 2821271918
269 2833712968
270 2852635370
271 2910810884
272 2919054269
273 2919542689
274 2928093306
275 2932429773
276 2964328334
277 2984583048
278 8045833289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

27

76

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9222 27 114
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9162 37 96
6ghb-assembly2.cif.gz_D crystal structure of spx in complex with yjbh (oxidized) 0.915 51 95
6gho-assembly1.cif.gz_B crystal structure of spx in complex with yjbh 0.9123 51 95
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9066 22 115
ID Description Score Start End Superfamily
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9405 23 107 1.10.10.10
af_P0ACL0_1_57_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.935 39 84 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9222 27 114 1.10.10.10
1wq2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9162 37 96 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9146 28 95 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A542RBW1-F1-model_v4 deleted 0.997 22 119
AF-A0A1I6YLZ3-F1-model_v4 Transcriptional regulator, ArsR family 0.9964 23 119 GO:0003700
AF-A0A7K1TPD1-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9937 22 119 GO:0003700
AF-W0Z841-F1-model_v4 Regulatory protein ArsR 0.9915 21 119 GO:0003700
AF-A0A3D4PRL7-F1-model_v4 Transcriptional regulator 0.9907 21 119 GO:0003700

Map