F175791

General Info

Members Datasets Scaffolds Average Seq Length
139 108 133 195

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_101019119|Ga0068864_1010191191
Length 239
Sequence MLPFLRLPFRDYGCGKAMSCDDLSRNHRRNRRPGLLVARQEYRSMNSTNPKVDFFFNKTGRWQEEFEKLRTIVLDCGLTEELKWGCPCYTFQKNNIVLIHGFKEYCALLFFKGALLKDPGRILIQQTENVQAARQIRFTSLREIVKMKPILKAYIHEAIEVDKAGLKVSFKKTKEFSVPEEFQARLDETPALKTAFAALTPGRQRAYILYFSAPKQSKTRVSRVEKYVPRILVGKGLDD

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
105 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
106 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0.72
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.47
Nodule 0
Rhizoplane 1.44
Rhizosphere 86.33
Stem 0
Stem Tuber 0
Unclassified 5.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10077296 3300001979 Bacteria 878
2 JGI24739J22299_10019968 3300001989 Bacteria 2395
3 JGI24739J22299_10026191 3300001989 Bacteria 2048
4 JGI24737J22298_10000187 3300001990 Bacteria 19990
5 JGI24735J21928_10000024 3300002067 Bacteria 95227
6 JGI25151J46595_10002675 3300003187 Bacteria 10431
7 JGI25151J46595_10007173 3300003187 Bacteria 5492
8 rootH1_10040117 3300003316 Bacteria 2024
9 rootH2_10303427 3300003320 Bacteria 1889
10 rootL2_10376615 3300003322 Unclassified 1123
11 rootH1_10013973 3300003323 Bacteria 3941
12 Ga0065704_10123043 3300005289 Bacteria 1740
13 Ga0065715_10150807 3300005293 Bacteria 1731
14 Ga0065707_10004837 3300005295 Bacteria 3382
15 Ga0065707_10248867 3300005295 Bacteria 1132
16 Ga0070690_100432991 3300005330 Bacteria 972
17 Ga0070670_100283347 3300005331 Bacteria 1447
18 Ga0070670_100424020 3300005331 Bacteria 1176
19 Ga0070677_10104269 3300005333 Bacteria 1256
20 Ga0068869_100009173 3300005334 Bacteria 6411
21 Ga0068869_100099890 3300005334 Bacteria 2193
22 Ga0070682_100845704 3300005337 Bacteria 747
23 Ga0070660_100103932 3300005339 Bacteria 2253
24 Ga0070660_100487941 3300005339 Unclassified 1024
25 Ga0070661_100003715 3300005344 Bacteria 10517
26 Ga0070675_100208280 3300005354 Bacteria 1699
27 Ga0070688_100486777 3300005365 Bacteria 928
28 Ga0070659_100070896 3300005366 Bacteria 2770
29 Ga0070700_100301321 3300005441 Bacteria 1170
30 Ga0070678_100115987 3300005456 Bacteria 2103
31 Ga0070698_100005786 3300005471 Bacteria 13525
32 Ga0070698_100362975 3300005471 Bacteria 1380
33 Ga0070699_100248057 3300005518 Bacteria 1590
34 Ga0070684_100057168 3300005535 Bacteria 3405
35 Ga0068853_100003607 3300005539 Bacteria 11855
36 Ga0070672_100219904 3300005543 Bacteria 1593
37 Ga0070695_100371380 3300005545 Bacteria 1077
38 Ga0070695_100483635 3300005545 Unclassified 955
39 Ga0070704_100203477 3300005549 Bacteria 1600
40 Ga0068855_100057490 3300005563 Bacteria 4559
41 Ga0070664_100955677 3300005564 Bacteria 804
42 Ga0068857_100010516 3300005577 Bacteria 8044
43 Ga0068857_100178701 3300005577 Bacteria 1931
44 Ga0068856_100582047 3300005614 Bacteria 1141
45 Ga0068859_100017521 3300005617 Bacteria 7200
46 Ga0068859_100179321 3300005617 Bacteria 2201
47 Ga0068864_101019119 3300005618 Bacteria 822
48 Ga0068858_100376010 3300005842 Bacteria 1363
49 Ga0068860_100805178 3300005843 Unclassified 953
50 Ga0075366_10091716 3300006195 Bacteria 1820
51 Ga0075370_10062631 3300006353 Bacteria 2120
52 Ga0075428_100197483 3300006844 Bacteria 2176
53 Ga0097620_100017520 3300006931 Bacteria 7200
54 Ga0097620_100179325 3300006931 Bacteria 2201
55 Ga0111539_10010730 3300009094 Bacteria 11530
56 Ga0111539_10055186 3300009094 Bacteria 4723
57 Ga0111539_10578724 3300009094 Bacteria 1308
58 Ga0105243_10440127 3300009148 Bacteria 1220
59 Ga0105242_11250449 3300009176 Bacteria 764
60 Ga0105237_10316975 3300009545 Bacteria 1562
61 Ga0105249_10014015 3300009553 Bacteria 7086
62 Ga0105246_10117130 3300011119 Bacteria 1968
63 Ga0157371_10010602 3300013102 Bacteria 7161
64 Ga0157371_10040924 3300013102 Bacteria 3308
65 Ga0157370_10307688 3300013104 Unclassified 1462
66 Ga0157370_11244217 3300013104 Bacteria 671
67 Ga0157378_10128574 3300013297 Bacteria 2342
68 Ga0157378_10136033 3300013297 Bacteria 2279
69 Ga0163162_10545945 3300013306 Bacteria 1287
70 Ga0157372_10009196 3300013307 Bacteria 10505
71 Ga0157372_10015762 3300013307 Bacteria 8107
72 Ga0157372_10137154 3300013307 Bacteria 2818
73 Ga0157372_10551906 3300013307 Bacteria 1343
74 Ga0157375_10218929 3300013308 Bacteria 2062
75 Ga0157380_10514497 3300014326 Bacteria 1166
76 Ga0157380_10662751 3300014326 Bacteria 1043
77 Ga0209026_1000453 3300025250 Bacteria 32465
78 Ga0209676_1000451 3300025292 Bacteria 69765
79 Ga0209025_1000568 3300025294 Bacteria 67279
80 Ga0209025_1002749 3300025294 Bacteria 17800
81 Ga0207682_10122742 3300025893 Bacteria 1153
82 Ga0207647_10018040 3300025904 Bacteria 4784
83 Ga0207643_10045067 3300025908 Bacteria 2490
84 Ga0207695_10128345 3300025913 Unclassified 2495
85 Ga0207660_10303719 3300025917 Bacteria 1271
86 Ga0207657_10309437 3300025919 Bacteria 1251
87 Ga0207657_10333985 3300025919 Bacteria 1197
88 Ga0207650_10723201 3300025925 Bacteria 842
89 Ga0207659_10160410 3300025926 Bacteria 1765
90 Ga0207686_10000291 3300025934 Bacteria 37159
91 Ga0207709_10308318 3300025935 Bacteria 1180
92 Ga0207670_10412264 3300025936 Bacteria 1082
93 Ga0207691_10257004 3300025940 Bacteria 1506
94 Ga0207689_10009496 3300025942 Bacteria 8399
95 Ga0207689_10023945 3300025942 Bacteria 5122
96 Ga0207689_10220982 3300025942 Bacteria 1565
97 Ga0207667_10078762 3300025949 Bacteria 3415
98 Ga0207667_10142233 3300025949 Unclassified 2470
99 Ga0207712_10460477 3300025961 Bacteria 1080
100 Ga0207640_10311240 3300025981 Bacteria 1250
101 Ga0207639_10080814 3300026041 Bacteria 2573
102 Ga0207708_10448117 3300026075 Bacteria 1075
103 Ga0207702_10194448 3300026078 Bacteria 1876
104 Ga0207702_10626659 3300026078 Bacteria 1057
105 Ga0207641_10095406 3300026088 Bacteria 2611
106 Ga0207676_10224759 3300026095 Bacteria 1674
107 Ga0207676_10368407 3300026095 Bacteria 1334
108 Ga0207674_10024370 3300026116 Bacteria 6468
109 Ga0207674_10229325 3300026116 Bacteria 1805
110 Ga0207683_10215435 3300026121 Bacteria 1749
111 Ga0207428_10070786 3300027907 Bacteria 2741
112 Ga0268265_10217206 3300028380 Bacteria 1670
113 Ga0268264_10761036 3300028381 Unclassified 965
114 Ga0265323_10007484 3300028653 Bacteria 4532
115 Ga0265338_10081376 3300028800 Bacteria 2716
116 Ga0265760_10077496 3300031090 Bacteria 1026
117 Ga0265327_10002707 3300031251 Bacteria 18175
118 Ga0451797_0732949 3300041453 Unclassified 878
119 Ga0466969_0186698 3300044656 Bacteria 948
120 Ga0453684_0000373 3300044712 Bacteria 183940
121 Ga0453684_0383857 3300044712 Bacteria 1577
122 Ga0466957_0005505 3300044842 Bacteria 7108
123 Ga0495634_0106045 3300046642 Bacteria 1811
124 Ga0495625_0027771 3300046660 Bacteria 4253
125 Ga0496102_0188369 3300048905 Bacteria 1944
126 Ga0501032_0507075 3300049569 Bacteria 771
127 Ga0501269_000151 3300049766 Bacteria 21375
128 nmdc:mga0k408_2098_c2 3300050493 Bacteria 8568
129 nmdc:mga07m45_164025_c1 3300050496 Bacteria 1290
130 nmdc:mga08y16_398798_c1 3300050511 Bacteria 1408
131 nmdc:mga08y16_97154_c1 3300050511 Bacteria 3067
132 nmdc:mga08y16_97191_c1 3300050511 Bacteria 3067
133 nmdc:mga0a205_452350_c1 3300050515 Bacteria 1144

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_11250449 Ga0105242_112504491 191
2 3300025934 Ga0207686_10000291 Ga0207686_100002917 191
3 3300025981 Ga0207640_10311240 Ga0207640_103112401 191
4 3300026095 Ga0207676_10368407 Ga0207676_103684072 191
5 3300028800 Ga0265338_10081376 Ga0265338_100813763 191
6 3300031090 Ga0265760_10077496 Ga0265760_100774962 191
7 3300003187 JGI25151J46595_10002675 JGI25151J46595_100026752 192
8 3300003187 JGI25151J46595_10007173 JGI25151J46595_100071733 192
9 3300003316 rootH1_10040117 rootH1_100401172 192
10 3300003320 rootH2_10303427 rootH2_103034273 192
11 3300003322 rootL2_10376615 rootL2_103766151 192
12 3300005293 Ga0065715_10150807 Ga0065715_101508073 192
13 3300005330 Ga0070690_100432991 Ga0070690_1004329912 192
14 3300005334 Ga0068869_100009173 Ga0068869_1000091737 192
15 3300005337 Ga0070682_100845704 Ga0070682_1008457041 192
16 3300005339 Ga0070660_100103932 Ga0070660_1001039324 192
17 3300005339 Ga0070660_100487941 Ga0070660_1004879412 192
18 3300005344 Ga0070661_100003715 Ga0070661_1000037159 192
19 3300005365 Ga0070688_100486777 Ga0070688_1004867771 192
20 3300005366 Ga0070659_100070896 Ga0070659_1000708963 192
21 3300005441 Ga0070700_100301321 Ga0070700_1003013212 192
22 3300005471 Ga0070698_100005786 Ga0070698_1000057865 192
23 3300005471 Ga0070698_100362975 Ga0070698_1003629751 192
24 3300005518 Ga0070699_100248057 Ga0070699_1002480571 192
25 3300005535 Ga0070684_100057168 Ga0070684_1000571683 192
26 3300005539 Ga0068853_100003607 Ga0068853_1000036078 192
27 3300005543 Ga0070672_100219904 Ga0070672_1002199043 192
28 3300005545 Ga0070695_100371380 Ga0070695_1003713801 192
29 3300005545 Ga0070695_100483635 Ga0070695_1004836352 192
30 3300005549 Ga0070704_100203477 Ga0070704_1002034771 192
31 3300005564 Ga0070664_100955677 Ga0070664_1009556772 192
32 3300005577 Ga0068857_100010516 Ga0068857_1000105168 192
33 3300005614 Ga0068856_100582047 Ga0068856_1005820472 192
34 3300005618 Ga0068864_101019119 Ga0068864_1010191191 192
35 3300005843 Ga0068860_100805178 Ga0068860_1008051782 192
36 3300009148 Ga0105243_10440127 Ga0105243_104401271 192
37 3300011119 Ga0105246_10117130 Ga0105246_101171302 192
38 3300013102 Ga0157371_10010602 Ga0157371_100106024 192
39 3300013104 Ga0157370_10307688 Ga0157370_103076883 192
40 3300013297 Ga0157378_10128574 Ga0157378_101285743 192
41 3300013297 Ga0157378_10136033 Ga0157378_101360333 192
42 3300013307 Ga0157372_10015762 Ga0157372_100157625 192
43 3300013307 Ga0157372_10137154 Ga0157372_101371544 192
44 3300013307 Ga0157372_10551906 Ga0157372_105519061 192
45 3300013308 Ga0157375_10218929 Ga0157375_102189295 192
46 3300025250 Ga0209026_1000453 Ga0209026_100045310 192
47 3300025292 Ga0209676_1000451 Ga0209676_100045168 192
48 3300025294 Ga0209025_1000568 Ga0209025_100056861 192
49 3300025294 Ga0209025_1002749 Ga0209025_100274912 192
50 3300025917 Ga0207660_10303719 Ga0207660_103037192 192
51 3300025919 Ga0207657_10309437 Ga0207657_103094372 192
52 3300025919 Ga0207657_10333985 Ga0207657_103339852 192
53 3300025926 Ga0207659_10160410 Ga0207659_101604101 192
54 3300025940 Ga0207691_10257004 Ga0207691_102570042 192
55 3300025942 Ga0207689_10023945 Ga0207689_100239456 192
56 3300026041 Ga0207639_10080814 Ga0207639_100808143 192
57 3300026075 Ga0207708_10448117 Ga0207708_104481171 192
58 3300026078 Ga0207702_10194448 Ga0207702_101944481 192
59 3300026078 Ga0207702_10626659 Ga0207702_106266592 192
60 3300026116 Ga0207674_10024370 Ga0207674_100243704 192
61 3300028381 Ga0268264_10761036 Ga0268264_107610361 192
62 3300031251 Ga0265327_10002707 Ga0265327_100027073 192
63 3300041453 Ga0451797_0732949 Ga0451797_0732949_214_804 192
64 3300044656 Ga0466969_0186698 Ga0466969_0186698_328_918 192
65 3300044842 Ga0466957_0005505 Ga0466957_0005505_6403_6981 192
66 3300046642 Ga0495634_0106045 Ga0495634_0106045_882_1475 192
67 3300048905 Ga0496102_0188369 Ga0496102_0188369_944_1531 192
68 3300049569 Ga0501032_0507075 Ga0501032_0507075_92_679 192
69 3300049766 Ga0501269_000151 Ga0501269_000151_5980_6558 192
70 3300050515 nmdc:mga0a205_452350_c1 nmdc:mga0a205_452350_c1_177_764 192
71 iso_pu_bacteria 2511231027 2511391144 192
72 iso_pu_bacteria 2842871566 2842874133 192
73 iso_pu_bacteria 2928078545 2928081738 192
74 iso_pu_bacteria 2928147474 2928150233 192
75 iso_pu_bacteria 2932082852 2932085059 192
76 iso_pu_bacteria 3001267043 3001267418 192
77 3300001979 JGI24740J21852_10077296 JGI24740J21852_100772962 193
78 3300001989 JGI24739J22299_10019968 JGI24739J22299_100199684 193
79 3300001989 JGI24739J22299_10026191 JGI24739J22299_100261912 193
80 3300001990 JGI24737J22298_10000187 JGI24737J22298_1000018718 193
81 3300002067 JGI24735J21928_10000024 JGI24735J21928_1000002427 193
82 3300003323 rootH1_10013973 rootH1_100139733 193
83 3300005289 Ga0065704_10123043 Ga0065704_101230432 193
84 3300005295 Ga0065707_10004837 Ga0065707_100048372 193
85 3300005295 Ga0065707_10248867 Ga0065707_102488672 193
86 3300005331 Ga0070670_100283347 Ga0070670_1002833472 193
87 3300005331 Ga0070670_100424020 Ga0070670_1004240202 193
88 3300005333 Ga0070677_10104269 Ga0070677_101042692 193
89 3300005334 Ga0068869_100099890 Ga0068869_1000998903 193
90 3300005354 Ga0070675_100208280 Ga0070675_1002082803 193
91 3300005456 Ga0070678_100115987 Ga0070678_1001159872 193
92 3300005563 Ga0068855_100057490 Ga0068855_1000574906 193
93 3300005577 Ga0068857_100178701 Ga0068857_1001787012 193
94 3300005617 Ga0068859_100017521 Ga0068859_1000175216 193
95 3300005617 Ga0068859_100179321 Ga0068859_1001793213 193
96 3300005842 Ga0068858_100376010 Ga0068858_1003760101 193
97 3300006195 Ga0075366_10091716 Ga0075366_100917161 193
98 3300006353 Ga0075370_10062631 Ga0075370_100626314 193
99 3300006844 Ga0075428_100197483 Ga0075428_1001974834 193
100 3300006931 Ga0097620_100017520 Ga0097620_1000175203 193
101 3300006931 Ga0097620_100179325 Ga0097620_1001793253 193
102 3300009094 Ga0111539_10010730 Ga0111539_100107306 193
103 3300009094 Ga0111539_10055186 Ga0111539_100551867 193
104 3300009094 Ga0111539_10578724 Ga0111539_105787242 193
105 3300009545 Ga0105237_10316975 Ga0105237_103169753 193
106 3300009553 Ga0105249_10014015 Ga0105249_100140156 193
107 3300013102 Ga0157371_10040924 Ga0157371_100409244 193
108 3300013104 Ga0157370_11244217 Ga0157370_112442171 193
109 3300013306 Ga0163162_10545945 Ga0163162_105459453 193
110 3300013307 Ga0157372_10009196 Ga0157372_100091965 193
111 3300014326 Ga0157380_10514497 Ga0157380_105144972 193
112 3300014326 Ga0157380_10662751 Ga0157380_106627512 193
113 3300025893 Ga0207682_10122742 Ga0207682_101227423 193
114 3300025904 Ga0207647_10018040 Ga0207647_100180405 193
115 3300025908 Ga0207643_10045067 Ga0207643_100450674 193
116 3300025913 Ga0207695_10128345 Ga0207695_101283451 193
117 3300025925 Ga0207650_10723201 Ga0207650_107232011 193
118 3300025935 Ga0207709_10308318 Ga0207709_103083182 193
119 3300025936 Ga0207670_10412264 Ga0207670_104122642 193
120 3300025942 Ga0207689_10009496 Ga0207689_100094967 193
121 3300025942 Ga0207689_10220982 Ga0207689_102209823 193
122 3300025949 Ga0207667_10078762 Ga0207667_100787624 193
123 3300025949 Ga0207667_10142233 Ga0207667_101422331 193
124 3300025961 Ga0207712_10460477 Ga0207712_104604772 193
125 3300026088 Ga0207641_10095406 Ga0207641_100954063 193
126 3300026095 Ga0207676_10224759 Ga0207676_102247592 193
127 3300026116 Ga0207674_10229325 Ga0207674_102293252 193
128 3300026121 Ga0207683_10215435 Ga0207683_102154352 193
129 3300027907 Ga0207428_10070786 Ga0207428_100707861 193
130 3300028380 Ga0268265_10217206 Ga0268265_102172061 193
131 3300028653 Ga0265323_10007484 Ga0265323_100074848 193
132 3300044712 Ga0453684_0000373 Ga0453684_0000373_79783_80403 193
133 3300044712 Ga0453684_0383857 Ga0453684_0383857_596_1186 193
134 3300046660 Ga0495625_0027771 Ga0495625_0027771_3000_3581 193
135 3300050493 nmdc:mga0k408_2098_c2 nmdc:mga0k408_2098_c2_797_1378 193
136 3300050496 nmdc:mga07m45_164025_c1 nmdc:mga07m45_164025_c1_70_660 193
137 3300050511 nmdc:mga08y16_398798_c1 nmdc:mga08y16_398798_c1_792_1382 193
138 3300050511 nmdc:mga08y16_97154_c1 nmdc:mga08y16_97154_c1_1830_2435 193
139 3300050511 nmdc:mga08y16_97191_c1 nmdc:mga08y16_97191_c1_1553_2143 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

62

159

0.98

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

175

234

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6462 5 125
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6395 6 115
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6238 5 125
7vfn-assembly1.cif.gz_A crystal structure of sdgb (sd peptide-binding form) 0.6177 22 64
7vfk-assembly1.cif.gz_A crystal structure of sdgb (ligand-free form) 0.6176 22 64
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.967 1 112 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9425 1 112 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6993 16 120 3.90.1150.30
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6747 2 118 3.90.1150.200
3swgA02 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.6747 19 49 3.65.10.10
ID Description Score Start End GO Terms
AF-A0A7V9ZMH7-F1-model_v4 DUF1801 domain-containing protein 0.9958 1 125
AF-A0A316DEU9-F1-model_v4 Uncharacterized protein DUF1801 0.994 1 107
AF-A0A7V9ZMH7-F1-model_v4 DUF1801 domain-containing protein 0.9879 1 125
AF-A0A5C7FL00-F1-model_v4 deleted 0.9867 28 114
AF-A0A6J7A2N7-F1-model_v4 Unannotated protein 0.9866 1 97

Feature Viewer

pLDDT pTM Quality
91.74 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map