F175768

General Info

Members Datasets Scaffolds Average Seq Length
139 110 130 189

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100555475|Ga0068856_1005554752
Length 210
Sequence VSLNLKLFRFSKHFCIEDLINKPLFEIIAIGGSAGSLPVLINILKVLPDNFSIPIVIVVHRLKNAFSEMDKILAVHFKQFRLCEPEDKTPIEKNHIYLAPQNYHLLVEEDKTFSLDYSELINYTRPSIDVSFNSISYVYHEKALAILLSGANRDGAEGIDNIILNGGTGIVQNPETAEYTAMPQSAINKNEHLKILYPQQIIDYISSLHN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
6 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
7 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
8 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
9 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
10 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
43 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
46 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
65 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
66 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
67 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
68 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
71 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
72 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
73 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
74 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
75 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
83 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
86 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
87 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
92 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
93 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
94 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
95 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
96 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
97 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
98 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
99 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
100 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
101 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
102 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
103 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
104 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
105 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
106 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
107 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
108 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
109 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
110 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.53
Metatranscriptomes 0
Isolates 6.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.9
Nodule 0
Rhizoplane 2.16
Rhizosphere 48.92
Stem 0
Stem Tuber 0
Unclassified 23.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663468 2162886007 Bacteria 272152
2 JGI24740J21852_10047809 3300001979 Unclassified 1246
3 JGI25159J45721_1022007 3300002987 Bacteria 1188
4 rootH1_10011263 3300003316 Bacteria 4568
5 rootH2_10012337 3300003320 Bacteria 34640
6 rootH2_10192078 3300003320 Bacteria 2594
7 rootL2_10013273 3300003322 Bacteria 17121
8 rootL2_10029706 3300003322 Bacteria 1919
9 rootL2_10029707 3300003322 Bacteria 2984
10 rootL2_10067572 3300003322 Bacteria 2216
11 rootL2_10110306 3300003322 Bacteria 1917
12 rootL2_10113328 3300003322 Bacteria 5764
13 rootL2_10245103 3300003322 Bacteria 3017
14 rootL2_10245104 3300003322 Bacteria 1806
15 rootH1_10000662 3300003323 Bacteria 213765
16 rootH1_10006795 3300003323 Bacteria 17484
17 rootH1_10023659 3300003323 Bacteria 3122
18 JGI25160J50197_1001048 3300003354 Bacteria 14264
19 JGI25160J50197_1017483 3300003354 Bacteria 2269
20 Ga0055531_10000516 3300003794 Bacteria 34880
21 Ga0065165_1007936 3300005262 Bacteria 5087
22 Ga0065704_10070133 3300005289 Bacteria 1266035
23 Ga0070668_101369813 3300005347 Bacteria 644
24 Ga0070698_100440542 3300005471 Bacteria 1238
25 Ga0068855_100592788 3300005563 Unclassified 1196
26 Ga0068857_100017701 3300005577 Bacteria 6249
27 Ga0068854_100618865 3300005578 Unclassified 926
28 Ga0068856_100555475 3300005614 Bacteria 1169
29 Ga0068860_100433128 3300005843 Bacteria 1305
30 Ga0068862_100781354 3300005844 Bacteria 931
31 Ga0081455_10481301 3300005937 Bacteria 839
32 Ga0075369_10235196 3300006186 Bacteria 849
33 Ga0075366_10124447 3300006195 Bacteria 1554
34 Ga0068871_100149427 3300006358 Bacteria 1991
35 Ga0075435_100310964 3300007076 Bacteria 1348
36 Ga0105240_10000047 3300009093 Bacteria 239067
37 Ga0114129_10011457 3300009147 Bacteria 12626
38 Ga0105237_10018906 3300009545 Bacteria 7123
39 Ga0105237_10967447 3300009545 Bacteria 858
40 Ga0105249_12165819 3300009553 Bacteria 629
41 Ga0105239_10000240 3300010375 Bacteria 81097
42 Ga0105239_10005057 3300010375 Bacteria 15581
43 Ga0105239_10121125 3300010375 Bacteria 2905
44 Ga0157374_10066827 3300013296 Bacteria 3379
45 Ga0157372_10382396 3300013307 Bacteria 1640
46 Ga0157375_11141753 3300013308 Bacteria 913
47 Ga0182005_1000059 3300015265 Bacteria 100130
48 Ga0209436_102343 3300025208 Bacteria 5787
49 Ga0209436_104078 3300025208 Bacteria 3685
50 Ga0209258_100068 3300025242 Bacteria 286288
51 Ga0209646_1003168 3300025246 Bacteria 3318
52 Ga0209130_1001990 3300025284 Bacteria 11205
53 Ga0207426_1000002 3300025302 Bacteria 1249660
54 Ga0207426_1000154 3300025302 Bacteria 179701
55 Ga0207426_1004910 3300025302 Bacteria 6312
56 Ga0209257_1000001 3300025304 Bacteria 2274655
57 Ga0207695_10000010 3300025913 Bacteria 981919
58 Ga0207667_10501053 3300025949 Bacteria 1232
59 Ga0207640_10559999 3300025981 Unclassified 962
60 Ga0207658_11281990 3300025986 Bacteria 670
61 Ga0207674_10020414 3300026116 Bacteria 7158
62 Ga0268264_10072810 3300028381 Bacteria 2914
63 Ga0265338_10014739 3300028800 Bacteria 8659
64 Ga0265324_10004993 3300029957 Bacteria 5831
65 Ga0307513_10683564 3300031456 Bacteria 732
66 Ga0307509_10017418 3300031507 Bacteria 8271
67 Ga0307509_10019381 3300031507 Bacteria 7761
68 Ga0307516_10316040 3300031730 Bacteria 1234
69 Ga0307414_10417251 3300032004 Bacteria 1169
70 Ga0307411_10058860 3300032005 Bacteria 2545
71 Ga0395898_0859882 3300037466 Unclassified 846
72 Ga0395905_0112467 3300037471 Bacteria 2558
73 Ga0439436_0007137 3300041404 Bacteria 3440
74 Ga0439439_0011023 3300041406 Bacteria 2169
75 Ga0439439_0025798 3300041406 Bacteria 1480
76 Ga0451789_0303638 3300041443 Bacteria 639
77 Ga0451802_1063870 3300041460 Bacteria 1115
78 Ga0451802_1230981 3300041460 Bacteria 1012
79 Ga0451851_0517167 3300041507 Unclassified 993
80 Ga0451851_1190977 3300041507 Unclassified 1309
81 Ga0451853_2581487 3300041512 Bacteria 1340
82 Ga0439431_0017076 3300041997 Bacteria 1703
83 Ga0439433_0142914 3300041999 Unclassified 613
84 Ga0439449_0025288 3300042007 Bacteria 2219
85 Ga0439449_0051116 3300042007 Bacteria 1529
86 Ga0439457_000069 3300042014 Bacteria 22453
87 Ga0439457_007469 3300042014 Bacteria 2622
88 Ga0439462_0037470 3300042015 Unclassified 1292
89 Ga0450897_029605 3300042128 Viruses 616
90 Ga0466972_0000052 3300044658 Bacteria 113449
91 Ga0466972_0007489 3300044658 Bacteria 5484
92 Ga0466966_0462971 3300044684 Unclassified 762
93 Ga0466957_0002196 3300044842 Bacteria 10460
94 Ga0466957_0088376 3300044842 Bacteria 1939
95 Ga0495638_0058911 3300046460 Bacteria 2379
96 Ga0495622_0202815 3300046557 Unclassified 883
97 Ga0496121_0000468 3300048924 Bacteria 78727
98 Ga0496124_0288164 3300048927 Bacteria 1193
99 Ga0496126_0017435 3300048929 Bacteria 7155
100 Ga0501047_0035268 3300049581 Bacteria 4833
101 Ga0501047_0075082 3300049581 Bacteria 3253
102 Ga0501073_0668675 3300049589 Bacteria 717
103 Ga0501257_057123 3300049686 Bacteria 981
104 Ga0501225_0000536 3300049705 Bacteria 11884
105 Ga0501080_0631571 3300049742 Bacteria 949
106 Ga0501241_000405 3300049758 Bacteria 9453
107 Ga0501044_0018868 3300049823 Bacteria 7385
108 nmdc:mga0k408_21143_c1 3300050493 Bacteria 3652
109 nmdc:mga05p37_7963_c1 3300050507 Bacteria 12508
110 nmdc:mga0rr50_639831_c1 3300050513 Bacteria 907
111 Ga0500578_0000018 3300053086 Bacteria 172537
112 Ga0500578_0187679 3300053086 Bacteria 1271
113 Ga0500644_0000370 3300053088 Bacteria 22056
114 Ga0500646_0003567 3300053090 Bacteria 3985
115 Ga0500583_0000024 3300053092 Bacteria 110944
116 Ga0500651_0597789 3300053093 Unclassified 599
117 Ga0500556_0104200 3300053104 Bacteria 1095
118 Ga0500572_256079 3300053111 Bacteria 569
119 Ga0500607_116095 3300053121 Bacteria 1304
120 Ga0500652_028936 3300053131 Bacteria 2157
121 Ga0500568_0025808 3300053139 Bacteria 2473
122 Ga0500590_031501 3300053148 Bacteria 2750
123 Ga0500616_0157390 3300053153 Bacteria 1045
124 Ga0500622_0000320 3300053156 Bacteria 48271
125 Ga0500622_0042052 3300053156 Bacteria 2376
126 Ga0500634_0052181 3300053161 Bacteria 2197
127 Ga0500636_0008362 3300053177 Bacteria 6003
128 Ga0500636_0233960 3300053177 Bacteria 948
129 Ga0500645_049927 3300053730 Unclassified 1222
130 Ga0500661_012998 3300055283 Bacteria 1501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053093 Ga0500651_0597789 Ga0500651_0597789_20_508 162
2 3300041507 Ga0451851_1190977 Ga0451851_1190977_797_1294 165
3 3300041443 Ga0451789_0303638 Ga0451789_0303638_126_629 167
4 3300041999 Ga0439433_0142914 Ga0439433_0142914_77_586 169
5 iso_pu_bacteria 2929177148 2929181987 170
6 iso_pu_bacteria 2945977869 2945977927 170
7 iso_pu_bacteria 2946013367 2946016220 170
8 3300044658 Ga0466972_0007489 Ga0466972_0007489_2342_2857 171
9 3300053111 Ga0500572_256079 Ga0500572_256079_43_558 171
10 3300053131 Ga0500652_028936 Ga0500652_028936_1627_2142 171
11 3300005578 Ga0068854_100618865 Ga0068854_1006188652 174
12 3300025981 Ga0207640_10559999 Ga0207640_105599992 174
13 3300003320 rootH2_10012337 rootH2_100123373 177
14 3300003323 rootH1_10006795 rootH1_100067959 177
15 3300009093 Ga0105240_10000047 Ga0105240_1000004726 179
16 3300010375 Ga0105239_10000240 Ga0105239_1000024025 179
17 3300025913 Ga0207695_10000010 Ga0207695_10000010213 179
18 3300032004 Ga0307414_10417251 Ga0307414_104172512 179
19 3300032005 Ga0307411_10058860 Ga0307411_100588602 179
20 3300041460 Ga0451802_1063870 Ga0451802_1063870_486_1025 179
21 3300050513 nmdc:mga0rr50_639831_c1 nmdc:mga0rr50_639831_c1_156_695 179
22 3300005937 Ga0081455_10481301 Ga0081455_104813012 181
23 3300003322 rootL2_10029707 rootL2_100297073 182
24 3300006358 Ga0068871_100149427 Ga0068871_1001494272 182
25 3300041507 Ga0451851_0517167 Ga0451851_0517167_295_843 182
26 iso_pu_bacteria 2929239360 2929244870 182
27 3300003322 rootL2_10013273 rootL2_100132733 183
28 3300003322 rootL2_10110306 rootL2_101103061 183
29 3300003322 rootL2_10245103 rootL2_102451032 183
30 3300003322 rootL2_10245104 rootL2_102451042 183
31 3300003794 Ga0055531_10000516 Ga0055531_100005167 183
32 3300005262 Ga0065165_1007936 Ga0065165_10079363 183
33 3300010375 Ga0105239_10121125 Ga0105239_101211253 183
34 3300015265 Ga0182005_1000059 Ga0182005_100005950 183
35 3300025208 Ga0209436_104078 Ga0209436_1040783 183
36 3300025242 Ga0209258_100068 Ga0209258_100068234 183
37 3300025302 Ga0207426_1004910 Ga0207426_10049105 183
38 3300025304 Ga0209257_1000001 Ga0209257_10000011000 183
39 3300041997 Ga0439431_0017076 Ga0439431_0017076_462_1022 183
40 3300044842 Ga0466957_0088376 Ga0466957_0088376_633_1196 183
41 3300046557 Ga0495622_0202815 Ga0495622_0202815_134_694 183
42 3300048924 Ga0496121_0000468 Ga0496121_0000468_16868_17431 183
43 3300048929 Ga0496126_0017435 Ga0496126_0017435_3984_4544 183
44 3300049758 Ga0501241_000405 Ga0501241_000405_7318_7878 183
45 3300053088 Ga0500644_0000370 Ga0500644_0000370_11092_11652 183
46 3300053121 Ga0500607_116095 Ga0500607_116095_379_939 183
47 3300053148 Ga0500590_031501 Ga0500590_031501_958_1518 183
48 3300053156 Ga0500622_0000320 Ga0500622_0000320_30689_31249 183
49 3300053161 Ga0500634_0052181 Ga0500634_0052181_1623_2183 183
50 3300053177 Ga0500636_0008362 Ga0500636_0008362_1332_1892 183
51 3300055283 Ga0500661_012998 Ga0500661_012998_704_1264 183
52 iso_pu_bacteria 2818991442 2819572630 183
53 iso_pu_bacteria 2821136567 2821139971 183
54 iso_pu_bacteria 2904467357 2904472089 183
55 3300003323 rootH1_10000662 rootH1_1000066281 185
56 3300005471 Ga0070698_100440542 Ga0070698_1004405422 185
57 3300006195 Ga0075366_10124447 Ga0075366_101244472 185
58 3300007076 Ga0075435_100310964 Ga0075435_1003109642 185
59 3300037466 Ga0395898_0859882 Ga0395898_0859882_192_764 185
60 3300041404 Ga0439436_0007137 Ga0439436_0007137_1706_2263 185
61 3300041406 Ga0439439_0011023 Ga0439439_0011023_1602_2159 185
62 3300041512 Ga0451853_2581487 Ga0451853_2581487_514_1098 185
63 3300042007 Ga0439449_0051116 Ga0439449_0051116_524_1081 185
64 3300042014 Ga0439457_000069 Ga0439457_000069_6124_6681 185
65 3300042015 Ga0439462_0037470 Ga0439462_0037470_198_770 185
66 3300049705 Ga0501225_0000536 Ga0501225_0000536_642_1214 185
67 3300050493 nmdc:mga0k408_21143_c1 nmdc:mga0k408_21143_c1_1939_2523 185
68 3300053104 Ga0500556_0104200 Ga0500556_0104200_253_825 185
69 3300053153 Ga0500616_0157390 Ga0500616_0157390_174_746 185
70 iso_pu_bacteria 2738541278 2738729539 185
71 3300001979 JGI24740J21852_10047809 JGI24740J21852_100478092 186
72 3300003320 rootH2_10192078 rootH2_101920782 186
73 3300003322 rootL2_10113328 rootL2_101133282 186
74 3300003323 rootH1_10023659 rootH1_100236593 186
75 3300005347 Ga0070668_101369813 Ga0070668_1013698131 186
76 3300006186 Ga0075369_10235196 Ga0075369_102351962 186
77 3300009545 Ga0105237_10018906 Ga0105237_100189066 186
78 3300009553 Ga0105249_12165819 Ga0105249_121658191 186
79 3300010375 Ga0105239_10005057 Ga0105239_100050576 186
80 3300028800 Ga0265338_10014739 Ga0265338_100147397 186
81 3300029957 Ga0265324_10004993 Ga0265324_100049933 186
82 3300002987 JGI25159J45721_1022007 JGI25159J45721_10220071 187
83 3300003354 JGI25160J50197_1017483 JGI25160J50197_10174833 187
84 3300005577 Ga0068857_100017701 Ga0068857_1000177013 187
85 3300005614 Ga0068856_100555475 Ga0068856_1005554752 187
86 3300005843 Ga0068860_100433128 Ga0068860_1004331282 187
87 3300009545 Ga0105237_10967447 Ga0105237_109674472 187
88 3300013296 Ga0157374_10066827 Ga0157374_100668272 187
89 3300013308 Ga0157375_11141753 Ga0157375_111417532 187
90 3300025208 Ga0209436_102343 Ga0209436_1023435 187
91 3300025246 Ga0209646_1003168 Ga0209646_10031683 187
92 3300025284 Ga0209130_1001990 Ga0209130_10019907 187
93 3300025302 Ga0207426_1000154 Ga0207426_1000154107 187
94 3300026116 Ga0207674_10020414 Ga0207674_100204144 187
95 3300028381 Ga0268264_10072810 Ga0268264_100728102 187
96 3300031507 Ga0307509_10017418 Ga0307509_100174182 187
97 3300031730 Ga0307516_10316040 Ga0307516_103160402 187
98 3300041460 Ga0451802_1230981 Ga0451802_1230981_129_710 187
99 3300042128 Ga0450897_029605 Ga0450897_029605_13_597 187
100 3300044658 Ga0466972_0000052 Ga0466972_0000052_88950_89534 187
101 3300044842 Ga0466957_0002196 Ga0466957_0002196_7866_8450 187
102 3300046460 Ga0495638_0058911 Ga0495638_0058911_1086_1670 187
103 3300049581 Ga0501047_0035268 Ga0501047_0035268_3593_4177 187
104 3300049581 Ga0501047_0075082 Ga0501047_0075082_2370_2954 187
105 3300049823 Ga0501044_0018868 Ga0501044_0018868_3395_3979 187
106 3300053086 Ga0500578_0187679 Ga0500578_0187679_494_1078 187
107 3300053090 Ga0500646_0003567 Ga0500646_0003567_2390_2968 187
108 3300053092 Ga0500583_0000024 Ga0500583_0000024_2386_2964 187
109 3300053156 Ga0500622_0042052 Ga0500622_0042052_1677_2255 187
110 3300053177 Ga0500636_0233960 Ga0500636_0233960_19_603 187
111 3300003316 rootH1_10011263 rootH1_100112633 188
112 3300003322 rootL2_10029706 rootL2_100297062 188
113 3300003354 JGI25160J50197_1001048 JGI25160J50197_10010483 188
114 3300005563 Ga0068855_100592788 Ga0068855_1005927882 188
115 3300009147 Ga0114129_10011457 Ga0114129_1001145710 188
116 3300013307 Ga0157372_10382396 Ga0157372_103823962 188
117 3300025302 Ga0207426_1000002 Ga0207426_1000002172 188
118 3300025949 Ga0207667_10501053 Ga0207667_105010532 188
119 3300031456 Ga0307513_10683564 Ga0307513_106835641 188
120 3300041406 Ga0439439_0025798 Ga0439439_0025798_308_883 188
121 3300042007 Ga0439449_0025288 Ga0439449_0025288_596_1171 188
122 3300042014 Ga0439457_007469 Ga0439457_007469_428_1003 188
123 3300049686 Ga0501257_057123 Ga0501257_057123_147_734 188
124 3300050507 nmdc:mga05p37_7963_c1 nmdc:mga05p37_7963_c1_11780_12361 188
125 3300053730 Ga0500645_049927 Ga0500645_049927_182_763 188
126 3300003322 rootL2_10067572 rootL2_100675722 189
127 3300005844 Ga0068862_100781354 Ga0068862_1007813541 189
128 3300025986 Ga0207658_11281990 Ga0207658_112819901 189
129 3300031507 Ga0307509_10019381 Ga0307509_100193813 189
130 3300037471 Ga0395905_0112467 Ga0395905_0112467_1502_2086 189
131 3300048927 Ga0496124_0288164 Ga0496124_0288164_141_725 189
132 3300049589 Ga0501073_0668675 Ga0501073_0668675_76_651 189
133 3300049742 Ga0501080_0631571 Ga0501080_0631571_203_778 189
134 3300053086 Ga0500578_0000018 Ga0500578_0000018_108872_109465 189
135 3300053139 Ga0500568_0025808 Ga0500568_0025808_127_708 189
136 iso_pu_bacteria 2818991444 2819588879 189
137 2162886007 SwRhRL2b_contig_1663468 SwRhRL2b_0819.00004260 190
138 3300005289 Ga0065704_10070133 Ga0065704_100701331158 190
139 3300044684 Ga0466966_0462971 Ga0466966_0462971_51_644 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01339

CheB_methylest

CheB methylesterase

28

205

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.9115 1 185
6ymz-assembly5.cif.gz_E structure of the cheb methylsterase from p. atrosepticum scri1043 0.9076 3 185
6ymz-assembly4.cif.gz_D structure of the cheb methylsterase from p. atrosepticum scri1043 0.9055 3 185
1chd-assembly1.cif.gz_A cheb methylesterase domain 0.9019 1 182
6ymz-assembly1.cif.gz_A structure of the cheb methylsterase from p. atrosepticum scri1043 0.9016 3 185
ID Description Score Start End Superfamily
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9115 1 185 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9082 3 184 3.40.50.180
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.8886 1 185 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.8673 3 184 3.40.50.180
af_I1KGP7_65_324_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7329 4 52 3.90.550.10
ID Description Score Start End GO Terms
AF-L8JSR9-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9802 58 190 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-L8JSR9-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9659 58 190 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A4V1SKF4-F1-model_v4 deleted 0.9575 53 187
AF-A0A1J5PLZ3-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9558 2 182 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A829YKW3-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9555 3 185 GO:0000156
GO:0005737
GO:0006935
GO:0008984

Feature Viewer

pLDDT pTM Quality
91.02 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map