F174997

General Info

Members Datasets Scaffolds Average Seq Length
139 118 125 338

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10020004|rootH1_100200047
Length 350
Sequence MPDTLKTILAIRFSAMGDVAMTIPVMQQVLEQHPDIQIVFVSNKNWGALCAGIPRLIFFPADLKGAHKGFKGLYQLFKSIRQAHKIDAVADLHHVLRSQIVRTFFRLRGVPVAAIDKGRAEKKALARPEEKVLMPLTGTIERYATVFRQLGLSVIINPLRPVFGRQMLTEDMLAVTGPKEKDKWIGLAPFATYKEKTYPLEKMEDVLAALVRRSHTKVLLMGGGSSEVAQLTALAIKYPAAIIVAGQFRLPEEMAIISNLDVMISMDSANMHLASLFGVPVVSVWGATHPYAGFMGFGQSEANAVQLESLSCRPCSIFGNKPCFRGDHACMEWIPPAAITDKVLKVAGQQ

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
7 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
8 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
9 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
10 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
11 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
12 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
13 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
95 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
96 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
105 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
106 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
109 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
110 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
111 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
112 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
113 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
114 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
115 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
116 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
117 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
118 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.93
Metatranscriptomes 0
Isolates 10.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.9
Nodule 0
Rhizoplane 0
Rhizosphere 58.27
Stem 0
Stem Tuber 0
Unclassified 15.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004962 3300001979 Bacteria 5658
2 JGI25154J39366_1000001 3300002738 Bacteria 483450
3 JGI25159J45721_1019427 3300002987 Bacteria 1337
4 JGI25153J46596_10011612 3300003215 Bacteria 3876
5 rootH1_10020004 3300003316 Bacteria 9874
6 rootH2_10004707 3300003320 Bacteria 19403
7 rootH2_10058614 3300003320 Bacteria 4809
8 rootL2_10169259 3300003322 Bacteria 1881
9 rootL2_10209217 3300003322 Bacteria 3696
10 rootH1_10006952 3300003323 Bacteria 18299
11 rootH1_10008724 3300003323 Bacteria 8118
12 JGI25160J50197_1004817 3300003354 Bacteria 5755
13 JGI25160J50197_1014307 3300003354 Bacteria 2660
14 Ga0055535_1002354 3300003761 Bacteria 6820
15 Ga0055542_1002590 3300003762 Bacteria 5725
16 Ga0055526_1024185 3300003771 Bacteria 1998
17 Ga0055528_1000359 3300003790 Bacteria 37077
18 Ga0055531_10000045 3300003794 Bacteria 132131
19 Ga0065165_1000112 3300005262 Bacteria 135988
20 Ga0065165_1008627 3300005262 Bacteria 4729
21 Ga0065165_1018922 3300005262 Bacteria 2476
22 Ga0065714_10080909 3300005288 Bacteria 2409
23 Ga0065704_10101299 3300005289 Bacteria 2241
24 Ga0070676_10058474 3300005328 Bacteria 2285
25 Ga0070670_100009422 3300005331 Bacteria 8337
26 Ga0068869_100019734 3300005334 Bacteria 4612
27 Ga0070689_100015793 3300005340 Bacteria 5515
28 Ga0070668_100021739 3300005347 Bacteria 4847
29 Ga0070668_100058631 3300005347 Bacteria 2979
30 Ga0070669_100004598 3300005353 Bacteria 9963
31 Ga0070669_100025703 3300005353 Bacteria 4230
32 Ga0070675_100050448 3300005354 Bacteria 3416
33 Ga0070674_100074880 3300005356 Bacteria 2403
34 Ga0070700_100027733 3300005441 Bacteria 3361
35 Ga0070663_100037297 3300005455 Bacteria 3383
36 Ga0070662_100208566 3300005457 Bacteria 1554
37 Ga0068867_100010794 3300005459 Bacteria 6444
38 Ga0070698_100176752 3300005471 Bacteria 2074
39 Ga0070672_100060445 3300005543 Bacteria 2983
40 Ga0070672_100381072 3300005543 Bacteria 1206
41 Ga0070664_100232607 3300005564 Bacteria 1652
42 Ga0068854_100398119 3300005578 Bacteria 1139
43 Ga0068859_100312874 3300005617 Bacteria 1664
44 Ga0068866_10021457 3300005718 Bacteria 2975
45 Ga0068861_100092990 3300005719 Bacteria 2383
46 Ga0068870_10037178 3300005840 Bacteria 2508
47 Ga0068871_100088867 3300006358 Bacteria 2572
48 Ga0097620_100312862 3300006931 Bacteria 1664
49 Ga0105243_10334709 3300009148 Bacteria 1384
50 Ga0105242_10081977 3300009176 Bacteria 2699
51 Ga0105249_10021899 3300009553 Bacteria 5723
52 Ga0105249_10426428 3300009553 Bacteria 1361
53 Ga0157373_10218842 3300013100 Bacteria 1343
54 Ga0157378_10047195 3300013297 Bacteria 3828
55 Ga0157378_10242277 3300013297 Bacteria 1723
56 Ga0163162_10160263 3300013306 Unclassified 2371
57 Ga0163162_10174648 3300013306 Bacteria 2274
58 Ga0157375_10013642 3300013308 Bacteria 7242
59 Ga0157375_10163306 3300013308 Bacteria 2371
60 Ga0157375_10193138 3300013308 Bacteria 2191
61 Ga0157380_10001574 3300014326 Bacteria 15001
62 Ga0157377_10001511 3300014745 Bacteria 10084
63 Ga0157376_10228466 3300014969 Bacteria 1727
64 Ga0182005_1000076 3300015265 Bacteria 79167
65 Ga0209436_102554 3300025208 Bacteria 5381
66 Ga0209258_100041 3300025242 Bacteria 381381
67 Ga0209646_1000002 3300025246 Bacteria 1425781
68 Ga0209026_1000218 3300025250 Bacteria 79205
69 Ga0209148_1000375 3300025254 Bacteria 54278
70 Ga0209673_1000096 3300025273 Bacteria 194819
71 Ga0209130_1001124 3300025284 Bacteria 19660
72 Ga0209564_1001415 3300025295 Bacteria 24742
73 Ga0209758_1001132 3300025297 Bacteria 34267
74 Ga0209758_1003569 3300025297 Bacteria 13961
75 Ga0209758_1024723 3300025297 Bacteria 2665
76 Ga0209050_1000207 3300025298 Bacteria 131328
77 Ga0207426_1000275 3300025302 Bacteria 106256
78 Ga0207426_1000699 3300025302 Bacteria 39800
79 Ga0207426_1001471 3300025302 Bacteria 19401
80 Ga0209257_1000001 3300025304 Bacteria 2274655
81 Ga0209257_1001870 3300025304 Bacteria 22825
82 Ga0207680_10132284 3300025903 Bacteria 1645
83 Ga0207645_10042561 3300025907 Bacteria 2906
84 Ga0207643_10043148 3300025908 Bacteria 2544
85 Ga0207681_10027393 3300025923 Bacteria 3684
86 Ga0207681_10089903 3300025923 Bacteria 2190
87 Ga0207706_10036843 3300025933 Bacteria 4345
88 Ga0207670_10023953 3300025936 Bacteria 3808
89 Ga0207691_10028065 3300025940 Bacteria 5272
90 Ga0207691_10118307 3300025940 Bacteria 2350
91 Ga0207689_10135168 3300025942 Bacteria 2030
92 Ga0207679_10048352 3300025945 Bacteria 3096
93 Ga0207651_10022312 3300025960 Bacteria 3868
94 Ga0207668_10045936 3300025972 Bacteria 2981
95 Ga0207678_10040210 3300026067 Bacteria 4057
96 Ga0207648_10007442 3300026089 Bacteria 10767
97 Ga0207674_10040096 3300026116 Bacteria 4853
98 Ga0207675_100001768 3300026118 Bacteria 21608
99 Ga0268264_10158013 3300028381 Bacteria 2039
100 Ga0307416_100511161 3300032002 Unclassified 1268
101 Ga0307414_10124472 3300032004 Bacteria 1989
102 Ga0439465_0007660 3300041413 Bacteria 3427
103 Ga0439431_0015242 3300041997 Bacteria 1788
104 Ga0439433_0043610 3300041999 Unclassified 1048
105 Ga0439434_0001225 3300042435 Bacteria 7392
106 Ga0495633_0000336 3300046558 Bacteria 52701
107 Ga0495611_0020407 3300046648 Bacteria 2852
108 Ga0496121_0000030 3300048924 Bacteria 412079
109 Ga0496126_0048703 3300048929 Bacteria 3871
110 Ga0501298_009580 3300049521 Bacteria 1651
111 Ga0501047_0187000 3300049581 Bacteria 1936
112 Ga0501223_001143 3300049663 Bacteria 6252
113 Ga0501243_000554 3300049675 Bacteria 5023
114 Ga0501259_000168 3300049688 Bacteria 9927
115 Ga0501044_0104207 3300049823 Bacteria 2851
116 Ga0501212_016569 3300049851 Unclassified 1108
117 Ga0500644_0000160 3300053088 Bacteria 42538
118 Ga0500641_0054650 3300053096 Bacteria 1651
119 Ga0500569_000279 3300053109 Bacteria 8070
120 Ga0500607_053622 3300053121 Bacteria 2137
121 Ga0500658_0004336 3300053134 Bacteria 5318
122 Ga0500568_0000606 3300053139 Bacteria 25992
123 Ga0500616_0018948 3300053153 Bacteria 3887
124 Ga0500622_0000220 3300053156 Bacteria 60029
125 Ga0500661_005441 3300055283 Bacteria 2380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041999 Ga0439433_0043610 Ga0439433_0043610_149_1015 277
2 3300025903 Ga0207680_10132284 Ga0207680_101322841 306
3 3300005347 Ga0070668_100058631 Ga0070668_1000586313 310
4 3300025972 Ga0207668_10045936 Ga0207668_100459362 310
5 3300049663 Ga0501223_001143 Ga0501223_001143_4734_5690 311
6 3300053139 Ga0500568_0000606 Ga0500568_0000606_3562_4587 313
7 3300005356 Ga0070674_100074880 Ga0070674_1000748803 318
8 3300005459 Ga0068867_100010794 Ga0068867_1000107943 318
9 3300005718 Ga0068866_10021457 Ga0068866_100214573 318
10 3300009176 Ga0105242_10081977 Ga0105242_100819772 318
11 3300009553 Ga0105249_10426428 Ga0105249_104264282 318
12 3300026089 Ga0207648_10007442 Ga0207648_100074428 318
13 3300053096 Ga0500641_0054650 Ga0500641_0054650_584_1555 318
14 3300049675 Ga0501243_000554 Ga0501243_000554_274_1266 322
15 3300049688 Ga0501259_000168 Ga0501259_000168_3845_4837 322
16 3300049851 Ga0501212_016569 Ga0501212_016569_22_1014 322
17 iso_pu_bacteria 2896109856 2896112592 322
18 3300005617 Ga0068859_100312874 Ga0068859_1003128742 323
19 3300006931 Ga0097620_100312862 Ga0097620_1003128622 323
20 3300014969 Ga0157376_10228466 Ga0157376_102284662 324
21 3300032002 Ga0307416_100511161 Ga0307416_1005111611 324
22 3300053121 Ga0500607_053622 Ga0500607_053622_779_1789 324
23 3300003794 Ga0055531_10000045 Ga0055531_1000004568 325
24 3300005289 Ga0065704_10101299 Ga0065704_101012992 325
25 3300025304 Ga0209257_1000001 Ga0209257_10000011556 325
26 3300048929 Ga0496126_0048703 Ga0496126_0048703_1384_2436 325
27 3300005288 Ga0065714_10080909 Ga0065714_100809092 326
28 3300053088 Ga0500644_0000160 Ga0500644_0000160_38969_39988 326
29 3300013297 Ga0157378_10242277 Ga0157378_102422771 327
30 3300025940 Ga0207691_10118307 Ga0207691_101183072 327
31 3300032004 Ga0307414_10124472 Ga0307414_101244722 327
32 iso_pu_bacteria 2818991442 2819573435 327
33 iso_pu_bacteria 2821136567 2821136856 327
34 iso_pu_bacteria 2883068021 2883072549 327
35 iso_pu_bacteria 2896085136 2896087680 327
36 iso_pu_bacteria 2904467357 2904468400 327
37 3300005578 Ga0068854_100398119 Ga0068854_1003981191 329
38 3300013308 Ga0157375_10193138 Ga0157375_101931383 330
39 3300041997 Ga0439431_0015242 Ga0439431_0015242_95_1123 330
40 iso_pu_bacteria 2929239360 2929241074 330
41 3300003320 rootH2_10004707 rootH2_100047072 331
42 3300003323 rootH1_10006952 rootH1_100069528 331
43 3300005262 Ga0065165_1008627 Ga0065165_10086273 331
44 3300005353 Ga0070669_100025703 Ga0070669_1000257034 331
45 3300015265 Ga0182005_1000076 Ga0182005_100007671 331
46 3300025923 Ga0207681_10027393 Ga0207681_100273932 331
47 3300048924 Ga0496121_0000030 Ga0496121_0000030_107492_108496 331
48 3300055283 Ga0500661_005441 Ga0500661_005441_907_1920 331
49 3300003323 rootH1_10008724 rootH1_100087245 332
50 3300005328 Ga0070676_10058474 Ga0070676_100584742 335
51 3300025907 Ga0207645_10042561 Ga0207645_100425613 335
52 3300046648 Ga0495611_0020407 Ga0495611_0020407_385_1416 336
53 3300003761 Ga0055535_1002354 Ga0055535_10023544 337
54 3300003762 Ga0055542_1002590 Ga0055542_10025904 337
55 3300025242 Ga0209258_100041 Ga0209258_100041275 337
56 3300025254 Ga0209148_1000375 Ga0209148_100037513 337
57 3300028381 Ga0268264_10158013 Ga0268264_101580132 337
58 3300005455 Ga0070663_100037297 Ga0070663_1000372975 338
59 3300026067 Ga0207678_10040210 Ga0207678_100402106 338
60 3300049521 Ga0501298_009580 Ga0501298_009580_314_1348 338
61 3300053109 Ga0500569_000279 Ga0500569_000279_1381_2406 338
62 3300053134 Ga0500658_0004336 Ga0500658_0004336_1840_2865 338
63 3300053153 Ga0500616_0018948 Ga0500616_0018948_571_1596 338
64 3300005471 Ga0070698_100176752 Ga0070698_1001767522 339
65 3300005543 Ga0070672_100381072 Ga0070672_1003810721 339
66 3300006358 Ga0068871_100088867 Ga0068871_1000888673 339
67 3300013297 Ga0157378_10047195 Ga0157378_100471954 339
68 3300013306 Ga0163162_10160263 Ga0163162_101602632 339
69 3300013308 Ga0157375_10163306 Ga0157375_101633063 339
70 3300025945 Ga0207679_10048352 Ga0207679_100483522 339
71 3300042435 Ga0439434_0001225 Ga0439434_0001225_1970_3001 339
72 iso_pu_bacteria 2818991460 2819680942 339
73 iso_pu_bacteria 2884791551 2884795722 339
74 iso_pu_bacteria 2929177148 2929178716 339
75 iso_pu_bacteria 2929921140 2929923103 339
76 iso_pu_bacteria 2945977869 2945981128 339
77 iso_pu_bacteria 2946013367 2946019472 339
78 iso_pu_bacteria 8003151029 8003156917 339
79 3300003771 Ga0055526_1024185 Ga0055526_10241853 340
80 3300003790 Ga0055528_1000359 Ga0055528_100035914 340
81 3300005262 Ga0065165_1000112 Ga0065165_100011225 340
82 3300005331 Ga0070670_100009422 Ga0070670_1000094225 340
83 3300005334 Ga0068869_100019734 Ga0068869_1000197342 340
84 3300005340 Ga0070689_100015793 Ga0070689_1000157934 340
85 3300005347 Ga0070668_100021739 Ga0070668_1000217394 340
86 3300005353 Ga0070669_100004598 Ga0070669_1000045981 340
87 3300005354 Ga0070675_100050448 Ga0070675_1000504482 340
88 3300005441 Ga0070700_100027733 Ga0070700_1000277332 340
89 3300005457 Ga0070662_100208566 Ga0070662_1002085661 340
90 3300005543 Ga0070672_100060445 Ga0070672_1000604453 340
91 3300005564 Ga0070664_100232607 Ga0070664_1002326072 340
92 3300005719 Ga0068861_100092990 Ga0068861_1000929903 340
93 3300005840 Ga0068870_10037178 Ga0068870_100371782 340
94 3300009148 Ga0105243_10334709 Ga0105243_103347092 340
95 3300009553 Ga0105249_10021899 Ga0105249_100218993 340
96 3300013100 Ga0157373_10218842 Ga0157373_102188422 340
97 3300013306 Ga0163162_10174648 Ga0163162_101746483 340
98 3300013308 Ga0157375_10013642 Ga0157375_100136427 340
99 3300014326 Ga0157380_10001574 Ga0157380_100015744 340
100 3300014745 Ga0157377_10001511 Ga0157377_100015113 340
101 3300025273 Ga0209673_1000096 Ga0209673_100009688 340
102 3300025295 Ga0209564_1001415 Ga0209564_10014152 340
103 3300025297 Ga0209758_1001132 Ga0209758_100113228 340
104 3300025297 Ga0209758_1003569 Ga0209758_10035695 340
105 3300025298 Ga0209050_1000207 Ga0209050_1000207122 340
106 3300025302 Ga0207426_1000699 Ga0207426_100069914 340
107 3300025304 Ga0209257_1001870 Ga0209257_10018708 340
108 3300025908 Ga0207643_10043148 Ga0207643_100431482 340
109 3300025923 Ga0207681_10089903 Ga0207681_100899033 340
110 3300025933 Ga0207706_10036843 Ga0207706_100368434 340
111 3300025936 Ga0207670_10023953 Ga0207670_100239533 340
112 3300025940 Ga0207691_10028065 Ga0207691_100280653 340
113 3300025942 Ga0207689_10135168 Ga0207689_101351682 340
114 3300025960 Ga0207651_10022312 Ga0207651_100223124 340
115 3300026116 Ga0207674_10040096 Ga0207674_100400963 340
116 3300026118 Ga0207675_100001768 Ga0207675_10000176815 340
117 3300041413 Ga0439465_0007660 Ga0439465_0007660_552_1586 340
118 3300002987 JGI25159J45721_1019427 JGI25159J45721_10194272 341
119 3300003354 JGI25160J50197_1014307 JGI25160J50197_10143073 341
120 3300025208 Ga0209436_102554 Ga0209436_1025543 341
121 3300025284 Ga0209130_1001124 Ga0209130_10011247 341
122 3300025302 Ga0207426_1000275 Ga0207426_100027560 341
123 3300046558 Ga0495633_0000336 Ga0495633_0000336_43495_44541 342
124 3300053156 Ga0500622_0000220 Ga0500622_0000220_35284_36330 342
125 3300001979 JGI24740J21852_10004962 JGI24740J21852_100049625 343
126 3300002738 JGI25154J39366_1000001 JGI25154J39366_1000001398 343
127 3300003215 JGI25153J46596_10011612 JGI25153J46596_100116124 343
128 3300003316 rootH1_10020004 rootH1_100200047 343
129 3300003320 rootH2_10058614 rootH2_100586145 343
130 3300003322 rootL2_10169259 rootL2_101692591 343
131 3300003322 rootL2_10209217 rootL2_102092172 343
132 3300003354 JGI25160J50197_1004817 JGI25160J50197_10048175 343
133 3300005262 Ga0065165_1018922 Ga0065165_10189224 343
134 3300025246 Ga0209646_1000002 Ga0209646_1000002395 343
135 3300025250 Ga0209026_1000218 Ga0209026_100021839 343
136 3300025297 Ga0209758_1024723 Ga0209758_10247232 343
137 3300025302 Ga0207426_1001471 Ga0207426_100147122 343
138 3300049581 Ga0501047_0187000 Ga0501047_0187000_210_1256 343
139 3300049823 Ga0501044_0104207 Ga0501044_0104207_1302_2348 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01075

Glyco_transf_9

Glycosyltransferase family 9 (heptosyltransferase)

73

320

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.7498 2 342
2h1f-assembly2.cif.gz_B e. coli heptosyltransferase waac with adp 0.7455 3 339
6dfe-assembly1.cif.gz_A the structure of a ternary complex of e. coli waac 0.7425 3 343
6dfe-assembly1.cif.gz_A the structure of a ternary complex of e. coli waac 0.7404 3 343
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.7339 2 342
ID Description Score Start End Superfamily
4ovjA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8665 4 40 3.40.190.10
2h1fB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8368 179 339 3.40.50.2000
3tovB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7954 168 342 3.40.50.2000
1pswA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7704 176 342 3.40.50.2000
af_A0A0N7KD23_75_238_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7674 5 111 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A839IZC1-F1-model_v4 ADP-heptose--LPS heptosyltransferase RfaF 0.9613 2 96 GO:0005829
GO:0008713
GO:0009244
AF-M6RDB6-F1-model_v4 Heptosyltransferase domain protein 0.9589 9 157 GO:0005829
GO:0008713
GO:0009244
AF-A0A520HN27-F1-model_v4 Ribonucleotide reductase large subunit C-terminal domain-containing protein 0.9566 3 155 GO:0004748
GO:0005524
GO:0005971
GO:0009263
AF-A0A3D6BMC1-F1-model_v4 ADP-heptose--LPS heptosyltransferase RfaF 0.956 14 268 GO:0005829
GO:0008713
GO:0009244
AF-A0A641W5T1-F1-model_v4 deleted 0.9539 3 115

Feature Viewer

pLDDT pTM Quality
88.86 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map