F174005

General Info

Members Datasets Scaffolds Average Seq Length
138 103 276 273

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0117052|Ga0453684_0117052_2231_3163
Length 310
Sequence LGKNQNIPSPLLAAKVLLKPAAWSRKNPAMRILRGLLLSASFLASCACAGEWKLVWSDEFDRPGLPDATKWGYEEGFVRNNEAQYYTRQRSENARVEGGMLVIESRKERFKNPGFDPAAPAQSSSRKKREFAEYTSASLTTQGKASWTYGRIEVRAKLPSGRGTWPAIWMLGTNRSVGWPACGEVDIMEFVGYEPGIVHANIHTRKYNHVQKTNKGDKHALPDASEAFHVYAVEWFPDHMDFFVDGNKYFTFRNENTGADAWPFDKDHYLILNLAIGGAWGGTKGIDESIFPQKFLIDYVRVYQQGNPRP

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
60 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
61 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
62 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
66 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
67 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
68 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
75 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
76 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
77 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
82 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
90 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
93 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
94 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0
Rhizoplane 1.45
Rhizosphere 92.75
Stem 0
Stem Tuber 0
Unclassified 7.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0117052 3300044712 Unclassified 3225
2 Ga0065712_10111071 3300005290 Bacteria 1824
3 Ga0070670_100051955 3300005331 Bacteria 3519
4 Ga0070675_100223982 3300005354 Bacteria 1639
5 Ga0070673_100036036 3300005364 Bacteria 3757
6 Ga0070663_100027920 3300005455 Bacteria 3837
7 Ga0070681_10025249 3300005458 Bacteria 5976
8 Ga0070704_100029410 3300005549 Bacteria 3668
9 Ga0068855_100024787 3300005563 Bacteria 7176
10 Ga0070664_100020023 3300005564 Bacteria 5508
11 Ga0068857_100014272 3300005577 Bacteria 6922
12 Ga0070702_100065265 3300005615 Bacteria 2132
13 Ga0068864_100023934 3300005618 Bacteria 5132
14 Ga0068861_100109132 3300005719 Bacteria 2215
15 Ga0068863_100013715 3300005841 Bacteria 7813
16 Ga0068863_100121082 3300005841 Unclassified 2495
17 Ga0068860_100000749 3300005843 Bacteria 36941
18 Ga0068862_100230159 3300005844 Bacteria 1681
19 Ga0070717_10166614 3300006028 Unclassified 1914
20 Ga0075364_10030807 3300006051 Bacteria 3445
21 Ga0075364_10071532 3300006051 Bacteria 2285
22 Ga0075366_10033813 3300006195 Bacteria 3012
23 Ga0097621_100181889 3300006237 Bacteria 1817
24 Ga0075433_10042642 3300006852 Bacteria 3938
25 Ga0075433_10365054 3300006852 Bacteria 1275
26 Ga0075434_100011346 3300006871 Bacteria 8400
27 Ga0105240_10004143 3300009093 Bacteria 22214
28 Ga0111539_10210910 3300009094 Bacteria 2263
29 Ga0105245_10089995 3300009098 Bacteria 2822
30 Ga0114129_10006598 3300009147 Bacteria 16471
31 Ga0105248_10135097 3300009177 Bacteria 2782
32 Ga0105248_10377973 3300009177 Bacteria 1595
33 Ga0105237_10471193 3300009545 Unclassified 1262
34 Ga0163162_10068932 3300013306 Bacteria 3589
35 Ga0157375_10601107 3300013308 Bacteria 1259
36 Ga0157379_10272766 3300014968 Bacteria 1538
37 Ga0157376_10248171 3300014969 Bacteria 1661
38 Ga0157376_10519776 3300014969 Bacteria 1173
39 Ga0207643_10071217 3300025908 Bacteria 2001
40 Ga0207643_10137316 3300025908 Bacteria 1458
41 Ga0207695_10093443 3300025913 Bacteria 3017
42 Ga0207671_10205951 3300025914 Unclassified 1537
43 Ga0207650_10086036 3300025925 Bacteria 2392
44 Ga0207650_10232934 3300025925 Bacteria 1486
45 Ga0207687_10113871 3300025927 Bacteria 2012
46 Ga0207700_10184404 3300025928 Unclassified 1749
47 Ga0207644_10052743 3300025931 Bacteria 2924
48 Ga0207706_10156745 3300025933 Bacteria 2002
49 Ga0207691_10230873 3300025940 Bacteria 1602
50 Ga0207711_10248768 3300025941 Bacteria 1632
51 Ga0207679_10024369 3300025945 Bacteria 4148
52 Ga0207679_10111858 3300025945 Bacteria 2157
53 Ga0207667_10005089 3300025949 Bacteria 16058
54 Ga0207651_10479978 3300025960 Bacteria 1071
55 Ga0207639_10082067 3300026041 Unclassified 2555
56 Ga0207678_10041367 3300026067 Bacteria 3996
57 Ga0207708_10189410 3300026075 Bacteria 1637
58 Ga0207641_10181895 3300026088 Bacteria 1926
59 Ga0207676_10053842 3300026095 Bacteria 3151
60 Ga0207676_10726842 3300026095 Bacteria 964
61 Ga0207674_10021724 3300026116 Bacteria 6907
62 Ga0207675_100145322 3300026118 Bacteria 2255
63 Ga0207683_10086725 3300026121 Bacteria 2783
64 Ga0207683_10321549 3300026121 Bacteria 1417
65 Ga0207428_10075400 3300027907 Bacteria 2643
66 Ga0207428_10126077 3300027907 Bacteria 1961
67 Ga0268264_10001831 3300028381 Bacteria 19421
68 Ga0265338_10399548 3300028800 Bacteria 980
69 Ga0316576_10028546 3300031727 Bacteria 3934
70 Ga0373954_0046500 3300035118 Bacteria 2029
71 Ga0316582_0173989 3300036647 Bacteria 1463
72 Ga0316584_0201664 3300036712 Bacteria 1468
73 Ga0451797_0576331 3300041453 Bacteria 1238
74 Ga0451577_0008224 3300042876 Bacteria 10169
75 Ga0451577_0058389 3300042876 Bacteria 3439
76 Ga0451577_0070525 3300042876 Bacteria 3116
77 Ga0451577_0166788 3300042876 Bacteria 1984
78 Ga0451577_0215578 3300042876 Bacteria 1735
79 Ga0451577_0336799 3300042876 Bacteria 1368
80 Ga0451577_0752651 3300042876 Bacteria 881
81 Ga0453684_0000648 3300044712 Bacteria 125276
82 Ga0453684_0000688 3300044712 Bacteria 120333
83 Ga0453684_0004469 3300044712 Bacteria 29460
84 Ga0453684_0025689 3300044712 Bacteria 8541
85 Ga0453684_0489810 3300044712 Bacteria 1363
86 Ga0453684_0702694 3300044712 Bacteria 1098
87 Ga0451576_0001327 3300045051 Bacteria 42784
88 Ga0451576_0006381 3300045051 Bacteria 14480
89 Ga0451576_0019325 3300045051 Bacteria 7435
90 Ga0451576_0024558 3300045051 Bacteria 6510
91 Ga0451576_0126162 3300045051 Bacteria 2667
92 Ga0495651_0054777 3300046462 Bacteria 3065
93 Ga0495653_0023206 3300046463 Bacteria 5017
94 Ga0495662_0018587 3300046476 Bacteria 3364
95 Ga0495594_0036068 3300046499 Bacteria 2696
96 Ga0495628_0023560 3300046516 Bacteria 5052
97 Ga0495628_0047428 3300046516 Bacteria 3408
98 Ga0495630_0018307 3300046517 Bacteria 5143
99 Ga0495630_0129707 3300046517 Unclassified 1914
100 Ga0495652_0028463 3300046529 Bacteria 4916
101 Ga0495667_0004227 3300046559 Bacteria 9678
102 Ga0495634_0037394 3300046642 Bacteria 3316
103 Ga0495661_0006205 3300046665 Bacteria 8413
104 Ga0495599_0032765 3300046678 Bacteria 3262
105 Ga0495599_0137964 3300046678 Bacteria 1513
106 Ga0495623_0025794 3300046679 Bacteria 3785
107 Ga0495604_0096984 3300047317 Bacteria 2175
108 Ga0495674_0002950 3300047319 Bacteria 16541
109 Ga0495674_0134936 3300047319 Bacteria 2077
110 Ga0495674_0137012 3300047319 Unclassified 2059
111 Ga0495676_0321236 3300047321 Unclassified 1040
112 Ga0495680_0024218 3300047322 Bacteria 5037
113 Ga0495675_0088994 3300047444 Bacteria 1939
114 Ga0495684_0146889 3300047471 Bacteria 1765
115 Ga0496110_0294121 3300048913 Bacteria 1479
116 Ga0501036_0033684 3300049572 Bacteria 4332
117 Ga0501041_0148691 3300049577 Bacteria 1462
118 Ga0501042_0077546 3300049578 Bacteria 2379
119 Ga0501071_0029167 3300049587 Bacteria 3892
120 Ga0501072_0024725 3300049588 Bacteria 4675
121 Ga0501073_0309811 3300049589 Bacteria 1089
122 Ga0501075_0008809 3300049591 Bacteria 7033
123 Ga0501080_0077239 3300049742 Bacteria 3097
124 nmdc:mga00v17_49804_c1 3300050491 Bacteria 2542
125 nmdc:mga0k408_112597_c1 3300050493 Bacteria 1609
126 nmdc:mga0k408_43614_c1 3300050493 Unclassified 2585
127 nmdc:mga07m45_159889_c1 3300050496 Bacteria 1307
128 nmdc:mga05p37_142513_c1 3300050507 Bacteria 2935
129 nmdc:mga05p37_1766_c1 3300050507 Bacteria 25251
130 nmdc:mga09592_65223_c1 3300050508 Bacteria 3084
131 nmdc:mga0qj67_59696_c1 3300050509 Bacteria 3025
132 nmdc:mga08y16_222080_c1 3300050511 Bacteria 1956
133 nmdc:mga08y16_73214_c1 3300050511 Bacteria 3570
134 nmdc:mga0n895_45768_c1 3300050512 Bacteria 4272
135 nmdc:mga0a205_29254_c1 3300050515 Bacteria 5272
136 Ga0500645_013061 3300053730 Bacteria 2674
137 Ga0501082_0090379 3300060353 Bacteria 2644
138 2920111320 2920107658 Bacteria 10042636
139 Ga0453684_0117052
140 Ga0065712_10111071
141 Ga0070670_100051955
142 Ga0070675_100223982
143 Ga0070673_100036036
144 Ga0070663_100027920
145 Ga0070681_10025249
146 Ga0070704_100029410
147 Ga0068855_100024787
148 Ga0070664_100020023
149 Ga0068857_100014272
150 Ga0070702_100065265
151 Ga0068864_100023934
152 Ga0068861_100109132
153 Ga0068863_100013715
154 Ga0068863_100121082
155 Ga0068860_100000749
156 Ga0068862_100230159
157 Ga0070717_10166614
158 Ga0075364_10030807
159 Ga0075364_10071532
160 Ga0075366_10033813
161 Ga0097621_100181889
162 Ga0075433_10042642
163 Ga0075433_10365054
164 Ga0075434_100011346
165 Ga0105240_10004143
166 Ga0111539_10210910
167 Ga0105245_10089995
168 Ga0114129_10006598
169 Ga0105248_10135097
170 Ga0105248_10377973
171 Ga0105237_10471193
172 Ga0163162_10068932
173 Ga0157375_10601107
174 Ga0157379_10272766
175 Ga0157376_10248171
176 Ga0157376_10519776
177 Ga0207643_10071217
178 Ga0207643_10137316
179 Ga0207695_10093443
180 Ga0207671_10205951
181 Ga0207650_10086036
182 Ga0207650_10232934
183 Ga0207687_10113871
184 Ga0207700_10184404
185 Ga0207644_10052743
186 Ga0207706_10156745
187 Ga0207691_10230873
188 Ga0207711_10248768
189 Ga0207679_10024369
190 Ga0207679_10111858
191 Ga0207667_10005089
192 Ga0207651_10479978
193 Ga0207639_10082067
194 Ga0207678_10041367
195 Ga0207708_10189410
196 Ga0207641_10181895
197 Ga0207676_10053842
198 Ga0207676_10726842
199 Ga0207674_10021724
200 Ga0207675_100145322
201 Ga0207683_10086725
202 Ga0207683_10321549
203 Ga0207428_10075400
204 Ga0207428_10126077
205 Ga0268264_10001831
206 Ga0265338_10399548
207 Ga0316576_10028546
208 Ga0373954_0046500
209 Ga0316582_0173989
210 Ga0316584_0201664
211 Ga0451797_0576331
212 Ga0451577_0008224
213 Ga0451577_0058389
214 Ga0451577_0070525
215 Ga0451577_0166788
216 Ga0451577_0215578
217 Ga0451577_0336799
218 Ga0451577_0752651
219 Ga0453684_0000648
220 Ga0453684_0000688
221 Ga0453684_0004469
222 Ga0453684_0025689
223 Ga0453684_0489810
224 Ga0453684_0702694
225 Ga0451576_0001327
226 Ga0451576_0006381
227 Ga0451576_0019325
228 Ga0451576_0024558
229 Ga0451576_0126162
230 Ga0495651_0054777
231 Ga0495653_0023206
232 Ga0495662_0018587
233 Ga0495594_0036068
234 Ga0495628_0023560
235 Ga0495628_0047428
236 Ga0495630_0018307
237 Ga0495630_0129707
238 Ga0495652_0028463
239 Ga0495667_0004227
240 Ga0495634_0037394
241 Ga0495661_0006205
242 Ga0495599_0032765
243 Ga0495599_0137964
244 Ga0495623_0025794
245 Ga0495604_0096984
246 Ga0495674_0002950
247 Ga0495674_0134936
248 Ga0495674_0137012
249 Ga0495676_0321236
250 Ga0495680_0024218
251 Ga0495675_0088994
252 Ga0495684_0146889
253 Ga0496110_0294121
254 Ga0501036_0033684
255 Ga0501041_0148691
256 Ga0501042_0077546
257 Ga0501071_0029167
258 Ga0501072_0024725
259 Ga0501073_0309811
260 Ga0501075_0008809
261 Ga0501080_0077239
262 nmdc:mga00v17_49804_c1
263 nmdc:mga0k408_112597_c1
264 nmdc:mga0k408_43614_c1
265 nmdc:mga07m45_159889_c1
266 nmdc:mga05p37_142513_c1
267 nmdc:mga05p37_1766_c1
268 nmdc:mga09592_65223_c1
269 nmdc:mga0qj67_59696_c1
270 nmdc:mga08y16_222080_c1
271 nmdc:mga08y16_73214_c1
272 nmdc:mga0n895_45768_c1
273 nmdc:mga0a205_29254_c1
274 Ga0500645_013061
275 Ga0501082_0090379
276 2920111320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00722

Glyco_hydro_16

Glycosyl hydrolases family 16

81

301

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iln-assembly2.cif.gz_B x-ray structure of the laminarinase from rhodothermus marinus 0.981 44 280
7wwc-assembly1.cif.gz_A crystal structure of beta-1,3(4)-glucanase with laminaritriose 0.981 45 279
6xof-assembly1.cif.gz_A crystal structure of sclam, a non-specific endo-beta-1,3(4)-glucanase from family gh16 0.9606 46 281
5wut-assembly1.cif.gz_B crystal structure of laminarinase from flavobacterium sp. umi-01 0.9392 47 279
6xqf-assembly1.cif.gz_A crystal structure of sclam e144s mutant, a non-specific endo-beta-1,3(4)-glucanase from family gh16, co-crystallized with 1,3-beta-d-cellotriosyl-glucose, presenting a 1,3-beta-d-cellobiosyl-glucose at active site 0.9389 38 279
ID Description Score Start End Superfamily
3ilnA00 Mainly Beta;Sandwich;Jelly Rolls; 0.9803 44 280 2.60.120.200
5wutB00 Mainly Beta;Sandwich;Jelly Rolls; 0.9392 47 279 2.60.120.200
5wutB00 Mainly Beta;Sandwich;Jelly Rolls; 0.9353 47 279 2.60.120.200
3ilnA00 Mainly Beta;Sandwich;Jelly Rolls; 0.9226 44 280 2.60.120.200
2hykA00 Mainly Beta;Sandwich;Jelly Rolls; 0.9189 47 279 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A3M1IPG3-F1-model_v4 Glycoside hydrolase family 16 protein 0.9903 43 280 GO:0004553
GO:0005975
AF-A0A4Q3QHM7-F1-model_v4 deleted 0.9873 111 279
AF-A0A4Q3UN44-F1-model_v4 Glycoside hydrolase family 16 protein 0.9856 115 279 GO:0004553
GO:0005975
AF-A0A7V5DD15-F1-model_v4 Glycoside hydrolase family 16 protein 0.9853 49 279 GO:0004553
GO:0005975
AF-A0A2D7N9K7-F1-model_v4 Glycoside hydrolase 0.9836 74 279 GO:0004553
GO:0005975

Map