F174001

General Info

Members Datasets Scaffolds Average Seq Length
138 75 138 267

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0024858|Ga0453684_0024858_6712_7539
Length 275
Sequence MFSRLEKYRHAFLVGLQSNLVYRWNFAVRGFFSLFHLAAAFILWGAAYAGASQKMGNFSLNETLTYFVVLLVLQFFVSAFNEDYQISEEIRNGLINQFLLKPINYFAYRFSIFLAARLVSGALVIFPLLLALPVVYGNLTFPHDFPHDLWRLALGIPAMFLSAVIQFSIAYCFGLLTFWFLEIQGFVILSMAIETVLGGQMFPLDLLPAGIYNVAKFLPFYYQMYFPAAIFTGRIADSGTVVQGLCIQLIWVAVLLAIGHLLWVRGLKRHTAVGG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
27 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
28 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
29 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
30 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
31 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
32 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
33 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
34 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
51 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
52 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
56 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
70 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
71 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
73 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
74 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
75 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 0.72
Rhizosphere 93.48
Stem 0
Stem Tuber 0
Unclassified 3.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10016753 3300003320 Bacteria 6500
2 rootH2_10041485 3300003320 Bacteria 21931
3 rootL2_10002020 3300003322 Bacteria 8357
4 rootH1_10055740 3300003323 Unclassified 4216
5 Ga0070683_100027156 3300005329 Bacteria 5161
6 Ga0068869_100000077 3300005334 Bacteria 44272
7 Ga0068868_100094729 3300005338 Bacteria 2409
8 Ga0068868_100285122 3300005338 Bacteria 1399
9 Ga0070679_100005461 3300005530 Bacteria 11784
10 Ga0068855_100189994 3300005563 Bacteria 2317
11 Ga0068857_100146031 3300005577 Bacteria 2140
12 Ga0068856_100001065 3300005614 Bacteria 29026
13 Ga0068856_100059968 3300005614 Bacteria 3759
14 Ga0070717_10045890 3300006028 Bacteria 3574
15 Ga0070712_100038187 3300006175 Bacteria 3280
16 Ga0097621_100007938 3300006237 Bacteria 7616
17 Ga0097621_100082027 3300006237 Bacteria 2685
18 Ga0068871_100344200 3300006358 Bacteria 1317
19 Ga0105240_10628431 3300009093 Unclassified 1179
20 Ga0163163_10008043 3300014325 Bacteria 9342
21 Ga0207693_10194275 3300025915 Bacteria 1597
22 Ga0207704_10006158 3300025938 Bacteria 5568
23 Ga0207689_10000023 3300025942 Bacteria 107806
24 Ga0207661_10063156 3300025944 Bacteria 2999
25 Ga0207667_10242789 3300025949 Bacteria 1843
26 Ga0207677_10074486 3300026023 Bacteria 2409
27 Ga0207677_10287478 3300026023 Bacteria 1352
28 Ga0207702_10001117 3300026078 Bacteria 27430
29 Ga0207648_10007975 3300026089 Bacteria 10329
30 Ga0207674_10408365 3300026116 Bacteria 1312
31 Ga0265337_1022260 3300028556 Bacteria 1965
32 Ga0265337_1027020 3300028556 Bacteria 1733
33 Ga0265337_1034602 3300028556 Bacteria 1484
34 Ga0265337_1042682 3300028556 Bacteria 1300
35 Ga0265319_1000026 3300028563 Bacteria 141358
36 Ga0265319_1000660 3300028563 Bacteria 22674
37 Ga0265319_1004018 3300028563 Bacteria 7451
38 Ga0265319_1006188 3300028563 Bacteria 5581
39 Ga0265319_1014346 3300028563 Bacteria 3112
40 Ga0265319_1032349 3300028563 Bacteria 1814
41 Ga0265319_1047938 3300028563 Bacteria 1420
42 Ga0265334_10020137 3300028573 Bacteria 2735
43 Ga0265318_10000058 3300028577 Bacteria 111153
44 Ga0265318_10001672 3300028577 Bacteria 12761
45 Ga0265318_10001741 3300028577 Bacteria 12451
46 Ga0265318_10004848 3300028577 Bacteria 6426
47 Ga0265318_10005720 3300028577 Bacteria 5818
48 Ga0265318_10010128 3300028577 Bacteria 4118
49 Ga0265318_10012583 3300028577 Bacteria 3596
50 Ga0265336_10000884 3300028666 Bacteria 15381
51 Ga0265338_10003685 3300028800 Bacteria 21344
52 Ga0265338_10010892 3300028800 Bacteria 10580
53 Ga0265324_10003589 3300029957 Bacteria 7308
54 Ga0265324_10007129 3300029957 Bacteria 4571
55 Ga0265324_10035025 3300029957 Bacteria 1748
56 Ga0265320_10000721 3300031240 Bacteria 25291
57 Ga0265320_10002119 3300031240 Bacteria 13947
58 Ga0265320_10004595 3300031240 Bacteria 9022
59 Ga0265320_10009918 3300031240 Bacteria 5702
60 Ga0265320_10009934 3300031240 Bacteria 5696
61 Ga0265320_10023429 3300031240 Bacteria 3286
62 Ga0265320_10039916 3300031240 Bacteria 2343
63 Ga0265325_10038536 3300031241 Bacteria 2522
64 Ga0265339_10016679 3300031249 Bacteria 4371
65 Ga0265331_10104388 3300031250 Bacteria 1302
66 Ga0265327_10000016 3300031251 Bacteria 467439
67 Ga0265327_10002087 3300031251 Bacteria 22274
68 Ga0265327_10008628 3300031251 Bacteria 7553
69 Ga0265327_10027052 3300031251 Bacteria 3308
70 Ga0265327_10037354 3300031251 Bacteria 2660
71 Ga0265316_10012712 3300031344 Bacteria 7526
72 Ga0307408_100000032 3300031548 Bacteria 213693
73 Ga0265313_10002534 3300031595 Bacteria 15670
74 Ga0265313_10004397 3300031595 Bacteria 10867
75 Ga0265313_10005376 3300031595 Bacteria 9450
76 Ga0265313_10005485 3300031595 Bacteria 9310
77 Ga0265313_10015140 3300031595 Bacteria 4513
78 Ga0265313_10034144 3300031595 Bacteria 2575
79 Ga0265313_10080304 3300031595 Bacteria 1482
80 Ga0307508_10000022 3300031616 Bacteria 180417
81 Ga0265314_10004883 3300031711 Bacteria 12259
82 Ga0265314_10008750 3300031711 Bacteria 8652
83 Ga0265314_10062691 3300031711 Bacteria 2526
84 Ga0265342_10017987 3300031712 Bacteria 4589
85 Ga0265342_10127858 3300031712 Bacteria 1426
86 Ga0307410_10000015 3300031852 Bacteria 73395
87 Ga0307407_10012175 3300031903 Bacteria 4126
88 Ga0307412_10065578 3300031911 Bacteria 2458
89 Ga0307409_100000142 3300031995 Bacteria 26896
90 Ga0307416_100000038 3300032002 Bacteria 136704
91 Ga0395905_0157550 3300037471 Bacteria 2135
92 Ga0395905_0175571 3300037471 Bacteria 2012
93 Ga0451800_1208731 3300041459 Bacteria 1072
94 Ga0451577_0000024 3300042876 Bacteria 411758
95 Ga0451577_0171836 3300042876 Bacteria 1953
96 Ga0453683_0000472 3300044673 Bacteria 46292
97 Ga0453683_0055710 3300044673 Bacteria 2475
98 Ga0466966_0143243 3300044684 Bacteria 1459
99 Ga0466961_0052394 3300044693 Bacteria 2604
100 Ga0453684_0024858 3300044712 Bacteria 8724
101 Ga0453684_0127462 3300044712 Bacteria 3061
102 Ga0453684_0203327 3300044712 Bacteria 2307
103 Ga0451576_0000206 3300045051 Bacteria 147691
104 Ga0451576_0059132 3300045051 Bacteria 4002
105 Ga0451576_0065663 3300045051 Bacteria 3778
106 Ga0451576_0933730 3300045051 Bacteria 910
107 Ga0466967_0042259 3300045976 Bacteria 3937
108 Ga0495636_0164371 3300047318 Unclassified 1001
109 Ga0501032_0005382 3300049569 Bacteria 9524
110 Ga0501032_0091322 3300049569 Bacteria 2020
111 Ga0501033_0001439 3300049570 Bacteria 21134
112 Ga0501033_0026966 3300049570 Bacteria 4321
113 Ga0501036_0097455 3300049572 Bacteria 2485
114 Ga0501037_0076386 3300049573 Bacteria 2432
115 Ga0501037_0141475 3300049573 Bacteria 1721
116 Ga0501038_0022088 3300049574 Bacteria 5704
117 Ga0501039_0019388 3300049575 Bacteria 5213
118 Ga0501042_0003832 3300049578 Bacteria 9512
119 Ga0501046_0023119 3300049580 Bacteria 5118
120 Ga0501046_0140255 3300049580 Bacteria 1829
121 Ga0501046_0173522 3300049580 Bacteria 1616
122 Ga0501047_0011960 3300049581 Bacteria 8212
123 Ga0501047_0180634 3300049581 Bacteria 1976
124 Ga0501047_0275687 3300049581 Bacteria 1527
125 Ga0501048_0447020 3300049582 Bacteria 925
126 Ga0501243_004290 3300049675 Bacteria 2137
127 Ga0501083_0018999 3300049744 Bacteria 4784
128 Ga0501083_0050692 3300049744 Bacteria 2793
129 Ga0501083_0100166 3300049744 Bacteria 1910
130 Ga0501035_0005029 3300049822 Bacteria 12525
131 Ga0501035_0025596 3300049822 Bacteria 5408
132 Ga0501035_0092026 3300049822 Bacteria 2668
133 Ga0501035_0214020 3300049822 Bacteria 1648
134 Ga0501044_0003401 3300049823 Bacteria 17922
135 Ga0501044_0026181 3300049823 Bacteria 6177
136 Ga0500642_0191593 3300053130 Bacteria 954
137 Ga0500568_0033832 3300053139 Bacteria 2094
138 Ga0500622_0015969 3300053156 Bacteria 4017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041459 Ga0451800_1208731 Ga0451800_1208731_302_1045 247
2 3300053130 Ga0500642_0191593 Ga0500642_0191593_11_754 247
3 3300045976 Ga0466967_0042259 Ga0466967_0042259_29_781 250
4 3300014325 Ga0163163_10008043 Ga0163163_100080434 254
5 3300028577 Ga0265318_10000058 Ga0265318_1000005825 258
6 3300029957 Ga0265324_10035025 Ga0265324_100350252 258
7 3300031240 Ga0265320_10009934 Ga0265320_100099342 258
8 3300031249 Ga0265339_10016679 Ga0265339_100166795 258
9 3300031595 Ga0265313_10004397 Ga0265313_100043973 258
10 3300031711 Ga0265314_10004883 Ga0265314_100048835 258
11 3300031548 Ga0307408_100000032 Ga0307408_100000032150 260
12 3300031852 Ga0307410_10000015 Ga0307410_1000001550 260
13 3300031903 Ga0307407_10012175 Ga0307407_100121752 260
14 3300031911 Ga0307412_10065578 Ga0307412_100655783 260
15 3300031995 Ga0307409_100000142 Ga0307409_10000014225 260
16 3300032002 Ga0307416_100000038 Ga0307416_100000038105 260
17 3300049675 Ga0501243_004290 Ga0501243_004290_595_1389 264
18 3300028556 Ga0265337_1022260 Ga0265337_10222603 265
19 3300028556 Ga0265337_1027020 Ga0265337_10270202 265
20 3300028556 Ga0265337_1034602 Ga0265337_10346022 265
21 3300028563 Ga0265319_1006188 Ga0265319_10061883 265
22 3300028563 Ga0265319_1014346 Ga0265319_10143461 265
23 3300028573 Ga0265334_10020137 Ga0265334_100201372 265
24 3300028577 Ga0265318_10001672 Ga0265318_1000167210 265
25 3300028577 Ga0265318_10001741 Ga0265318_100017413 265
26 3300028577 Ga0265318_10004848 Ga0265318_100048485 265
27 3300028666 Ga0265336_10000884 Ga0265336_100008847 265
28 3300028800 Ga0265338_10003685 Ga0265338_100036857 265
29 3300028800 Ga0265338_10010892 Ga0265338_100108926 265
30 3300029957 Ga0265324_10003589 Ga0265324_100035894 265
31 3300029957 Ga0265324_10007129 Ga0265324_100071293 265
32 3300031240 Ga0265320_10004595 Ga0265320_100045955 265
33 3300031240 Ga0265320_10023429 Ga0265320_100234292 265
34 3300031241 Ga0265325_10038536 Ga0265325_100385363 265
35 3300031250 Ga0265331_10104388 Ga0265331_101043881 265
36 3300031251 Ga0265327_10002087 Ga0265327_100020878 265
37 3300031344 Ga0265316_10012712 Ga0265316_100127122 265
38 3300031595 Ga0265313_10005485 Ga0265313_100054859 265
39 3300031595 Ga0265313_10015140 Ga0265313_100151403 265
40 3300031595 Ga0265313_10034144 Ga0265313_100341443 265
41 3300031711 Ga0265314_10008750 Ga0265314_100087507 265
42 3300031251 Ga0265327_10027052 Ga0265327_100270522 266
43 3300005338 Ga0068868_100285122 Ga0068868_1002851222 268
44 3300006237 Ga0097621_100082027 Ga0097621_1000820272 268
45 3300026023 Ga0207677_10287478 Ga0207677_102874782 268
46 3300005334 Ga0068869_100000077 Ga0068869_10000007718 269
47 3300005338 Ga0068868_100094729 Ga0068868_1000947292 269
48 3300006028 Ga0070717_10045890 Ga0070717_100458903 269
49 3300006175 Ga0070712_100038187 Ga0070712_1000381872 269
50 3300006237 Ga0097621_100007938 Ga0097621_10000793810 269
51 3300006358 Ga0068871_100344200 Ga0068871_1003442002 269
52 3300025915 Ga0207693_10194275 Ga0207693_101942752 269
53 3300025938 Ga0207704_10006158 Ga0207704_100061584 269
54 3300025942 Ga0207689_10000023 Ga0207689_1000002314 269
55 3300026023 Ga0207677_10074486 Ga0207677_100744862 269
56 3300026089 Ga0207648_10007975 Ga0207648_100079758 269
57 3300028563 Ga0265319_1000660 Ga0265319_10006604 269
58 3300028563 Ga0265319_1004018 Ga0265319_10040188 269
59 3300028563 Ga0265319_1047938 Ga0265319_10479382 269
60 3300028577 Ga0265318_10012583 Ga0265318_100125832 269
61 3300031240 Ga0265320_10000721 Ga0265320_100007219 269
62 3300031240 Ga0265320_10002119 Ga0265320_100021199 269
63 3300031595 Ga0265313_10002534 Ga0265313_1000253410 269
64 3300031595 Ga0265313_10080304 Ga0265313_100803042 269
65 3300031616 Ga0307508_10000022 Ga0307508_1000002257 269
66 3300031711 Ga0265314_10062691 Ga0265314_100626913 269
67 3300031712 Ga0265342_10017987 Ga0265342_100179873 269
68 3300037471 Ga0395905_0157550 Ga0395905_0157550_1087_1896 269
69 3300037471 Ga0395905_0175571 Ga0395905_0175571_580_1389 269
70 3300042876 Ga0451577_0000024 Ga0451577_0000024_280379_281191 269
71 3300047318 Ga0495636_0164371 Ga0495636_0164371_73_882 269
72 3300049569 Ga0501032_0091322 Ga0501032_0091322_813_1625 269
73 3300049570 Ga0501033_0001439 Ga0501033_0001439_9697_10509 269
74 3300049573 Ga0501037_0076386 Ga0501037_0076386_1143_1955 269
75 3300049580 Ga0501046_0023119 Ga0501046_0023119_968_1780 269
76 3300049744 Ga0501083_0018999 Ga0501083_0018999_2909_3718 269
77 3300049744 Ga0501083_0100166 Ga0501083_0100166_394_1203 269
78 3300049822 Ga0501035_0025596 Ga0501035_0025596_1727_2539 269
79 3300049822 Ga0501035_0214020 Ga0501035_0214020_470_1279 269
80 3300049823 Ga0501044_0026181 Ga0501044_0026181_434_1243 269
81 3300003320 rootH2_10016753 rootH2_100167534 270
82 3300003320 rootH2_10041485 rootH2_100414857 270
83 3300003322 rootL2_10002020 rootL2_100020203 270
84 3300003323 rootH1_10055740 rootH1_100557404 270
85 3300005329 Ga0070683_100027156 Ga0070683_1000271567 270
86 3300005530 Ga0070679_100005461 Ga0070679_1000054614 270
87 3300005563 Ga0068855_100189994 Ga0068855_1001899942 270
88 3300005577 Ga0068857_100146031 Ga0068857_1001460312 270
89 3300005614 Ga0068856_100001065 Ga0068856_1000010658 270
90 3300005614 Ga0068856_100059968 Ga0068856_1000599683 270
91 3300009093 Ga0105240_10628431 Ga0105240_106284311 270
92 3300025944 Ga0207661_10063156 Ga0207661_100631561 270
93 3300025949 Ga0207667_10242789 Ga0207667_102427892 270
94 3300026078 Ga0207702_10001117 Ga0207702_1000111720 270
95 3300026116 Ga0207674_10408365 Ga0207674_104083651 270
96 3300028556 Ga0265337_1042682 Ga0265337_10426821 270
97 3300028563 Ga0265319_1000026 Ga0265319_100002676 270
98 3300028563 Ga0265319_1032349 Ga0265319_10323492 270
99 3300028577 Ga0265318_10005720 Ga0265318_100057202 270
100 3300028577 Ga0265318_10010128 Ga0265318_100101284 270
101 3300031240 Ga0265320_10009918 Ga0265320_100099189 270
102 3300031240 Ga0265320_10039916 Ga0265320_100399163 270
103 3300031251 Ga0265327_10000016 Ga0265327_10000016313 270
104 3300031251 Ga0265327_10008628 Ga0265327_100086286 270
105 3300031251 Ga0265327_10037354 Ga0265327_100373543 270
106 3300031595 Ga0265313_10005376 Ga0265313_100053763 270
107 3300031712 Ga0265342_10127858 Ga0265342_101278582 270
108 3300042876 Ga0451577_0171836 Ga0451577_0171836_954_1766 270
109 3300044673 Ga0453683_0000472 Ga0453683_0000472_40021_40833 270
110 3300044673 Ga0453683_0055710 Ga0453683_0055710_1415_2227 270
111 3300044684 Ga0466966_0143243 Ga0466966_0143243_570_1385 270
112 3300044693 Ga0466961_0052394 Ga0466961_0052394_517_1332 270
113 3300044712 Ga0453684_0024858 Ga0453684_0024858_6712_7539 270
114 3300044712 Ga0453684_0127462 Ga0453684_0127462_2025_2837 270
115 3300044712 Ga0453684_0203327 Ga0453684_0203327_359_1171 270
116 3300045051 Ga0451576_0000206 Ga0451576_0000206_98053_98865 270
117 3300045051 Ga0451576_0059132 Ga0451576_0059132_2132_2944 270
118 3300045051 Ga0451576_0065663 Ga0451576_0065663_773_1585 270
119 3300045051 Ga0451576_0933730 Ga0451576_0933730_41_853 270
120 3300049569 Ga0501032_0005382 Ga0501032_0005382_1805_2617 270
121 3300049570 Ga0501033_0026966 Ga0501033_0026966_2661_3473 270
122 3300049572 Ga0501036_0097455 Ga0501036_0097455_825_1637 270
123 3300049573 Ga0501037_0141475 Ga0501037_0141475_302_1114 270
124 3300049574 Ga0501038_0022088 Ga0501038_0022088_4341_5153 270
125 3300049575 Ga0501039_0019388 Ga0501039_0019388_4109_4921 270
126 3300049578 Ga0501042_0003832 Ga0501042_0003832_81_893 270
127 3300049580 Ga0501046_0140255 Ga0501046_0140255_715_1527 270
128 3300049580 Ga0501046_0173522 Ga0501046_0173522_213_1025 270
129 3300049581 Ga0501047_0011960 Ga0501047_0011960_113_925 270
130 3300049581 Ga0501047_0180634 Ga0501047_0180634_54_866 270
131 3300049581 Ga0501047_0275687 Ga0501047_0275687_113_925 270
132 3300049582 Ga0501048_0447020 Ga0501048_0447020_54_866 270
133 3300049744 Ga0501083_0050692 Ga0501083_0050692_417_1229 270
134 3300049822 Ga0501035_0005029 Ga0501035_0005029_4806_5618 270
135 3300049822 Ga0501035_0092026 Ga0501035_0092026_51_863 270
136 3300049823 Ga0501044_0003401 Ga0501044_0003401_6890_7702 270
137 3300053139 Ga0500568_0033832 Ga0500568_0033832_148_960 270
138 3300053156 Ga0500622_0015969 Ga0500622_0015969_191_1003 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06182

ABC2_membrane_6

ABC-2 family transporter protein

34

274

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jbh-assembly1.cif.gz_D cryo-em structure and transport mechanism of a wall teichoic acid abc transporter 0.6277 31 267
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.6256 12 261
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.608 12 261
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.5987 3 261
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.5935 3 261
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6397 60 257 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6295 61 257 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5878 59 254 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4679 61 257 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4661 60 257 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A1G4AIJ3-F1-model_v4 ABC transporter permease 0.9299 4 257 GO:0016020
AF-A0A1G4AIJ3-F1-model_v4 ABC transporter permease 0.9128 4 257 GO:0016020
AF-A0A1F9QWD4-F1-model_v4 ABC transporter permease 0.9082 6 270 GO:0016020
AF-A0A3M1IM14-F1-model_v4 ABC transporter permease 0.9081 35 270 GO:0016020
AF-A0A7C3DJF0-F1-model_v4 ABC transporter permease 0.9075 6 270 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.07 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map