F173739

General Info

Members Datasets Scaffolds Average Seq Length
138 100 276 357

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0063983|Ga0316574_0063983_904_2172
Length 422
Sequence VNGLIAALGEVGELLLHRVRHAWQTTGWRSSREDRSRVMGHNAAMVDSSPSSKDTLAGDSMNLPVQPPVEPMLAKLARAIPEGDGWLYEPKWDGFRCIVFRDGDRLELISRKLRPLGRYFPELLAPLRAALPDRCVVDGEIVVADADGHGLDFDALLQRIHPAESRINRLAGETPASFVAFDLLAHGDVALVDRPMADRRRALIAALDPNDVVRLTPATTDRTVADDWFHRFEGAGLDGVVAKPLDGTYQPGKRSLVKVKHQRTADCAVAGYRLHKDGQGVGSLLLGLFDDAGDMHSVGVAASFSAARRAELLAELEPRTRDALEGHPWRQWAEWDGDTTGAATSGGSRWNAGKDLSFVPIRMGLVAEVSFGQLEGRRFRHGVGFLRWRPDRTPQSCTYDQLDVADPVSFDDFVTAAGPPSD

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
50 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
51 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
55 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
58 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
59 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
60 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
61 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
62 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
63 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
64 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
70 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
71 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
72 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
75 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
76 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
77 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
78 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
79 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
80 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
81 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
82 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
83 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
90 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
91 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
92 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
93 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
94 2558860280 Kutzneria sp. 744 Isolate Unclassified
95 2643221692 Nocardia sp. Root136 Isolate Unclassified
96 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
97 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
98 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
99 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
100 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.2
Metatranscriptomes 0
Isolates 5.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0
Rhizoplane 0
Rhizosphere 88.41
Stem 0
Stem Tuber 0.72
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0063983 3300035398 Bacteria 2314
2 Ga0070658_10088828 3300005327 Bacteria 2544
3 Ga0070683_100208140 3300005329 Bacteria 1858
4 Ga0070668_100341523 3300005347 Bacteria 1265
5 Ga0070671_100007764 3300005355 Bacteria 8569
6 Ga0070714_100037585 3300005435 Bacteria 4069
7 Ga0068853_100145193 3300005539 Bacteria 2132
8 Ga0070665_100027883 3300005548 Bacteria 5686
9 Ga0068855_100009516 3300005563 Bacteria 11735
10 Ga0068854_100015623 3300005578 Bacteria 5036
11 Ga0068856_100017795 3300005614 Bacteria 6892
12 Ga0068860_100261172 3300005843 Bacteria 1688
13 Ga0081455_10000126 3300005937 Bacteria 88702
14 Ga0081539_10041489 3300005985 Bacteria 2689
15 Ga0075365_10085317 3300006038 Bacteria 2145
16 Ga0075365_10212118 3300006038 Bacteria 1357
17 Ga0075368_10034928 3300006042 Bacteria 1961
18 Ga0075363_100029418 3300006048 Bacteria 2836
19 Ga0075367_10040685 3300006178 Bacteria 2715
20 Ga0075367_10040840 3300006178 Bacteria 2710
21 Ga0075428_100317878 3300006844 Bacteria 1673
22 Ga0075430_100060155 3300006846 Bacteria 3193
23 Ga0075430_100222886 3300006846 Bacteria 1564
24 Ga0075431_100000382 3300006847 Bacteria 35471
25 Ga0075431_100186185 3300006847 Bacteria 2129
26 Ga0075429_100003659 3300006880 Bacteria 13092
27 Ga0105240_10006132 3300009093 Bacteria 17731
28 Ga0111539_10028036 3300009094 Bacteria 6876
29 Ga0111539_10030249 3300009094 Bacteria 6585
30 Ga0111539_10131530 3300009094 Bacteria 2930
31 Ga0114129_10147838 3300009147 Bacteria 3218
32 Ga0105243_10178332 3300009148 Bacteria 1846
33 Ga0105243_10222337 3300009148 Bacteria 1670
34 Ga0105241_10006595 3300009174 Bacteria 8552
35 Ga0105238_10050915 3300009551 Bacteria 4168
36 Ga0105238_10430910 3300009551 Bacteria 1314
37 Ga0105239_10056690 3300010375 Bacteria 4298
38 Ga0157380_10531566 3300014326 Bacteria 1149
39 Ga0157380_10607006 3300014326 Bacteria 1084
40 Ga0157377_10065514 3300014745 Bacteria 2087
41 Ga0157379_10074590 3300014968 Bacteria 3037
42 Ga0207647_10025808 3300025904 Bacteria 3853
43 Ga0207654_10015563 3300025911 Bacteria 3950
44 Ga0207695_10010569 3300025913 Bacteria 11285
45 Ga0207671_10000531 3300025914 Bacteria 51420
46 Ga0207694_10005816 3300025924 Bacteria 9451
47 Ga0207650_10151738 3300025925 Bacteria 1829
48 Ga0207664_10031197 3300025929 Bacteria 4076
49 Ga0207690_10139786 3300025932 Bacteria 1783
50 Ga0207640_10004187 3300025981 Bacteria 7804
51 Ga0207703_10092333 3300026035 Bacteria 2548
52 Ga0207698_10014048 3300026142 Bacteria 5308
53 Ga0268266_10023547 3300028379 Bacteria 5241
54 Ga0316576_10003375 3300031727 Bacteria 9339
55 Ga0316576_10051337 3300031727 Bacteria 3001
56 Ga0316576_10086000 3300031727 Bacteria 2338
57 Ga0307518_10174114 3300031838 Bacteria 1463
58 Ga0307409_100197236 3300031995 Bacteria 1798
59 Ga0307415_100012127 3300032126 Bacteria 4971
60 Ga0316583_10036694 3300032133 Bacteria 1738
61 Ga0307507_10179781 3300033179 Bacteria 1515
62 Ga0316574_0002484 3300035398 Bacteria 9264
63 Ga0316574_0004176 3300035398 Bacteria 7527
64 Ga0316574_0036552 3300035398 Bacteria 3007
65 Ga0316584_0022139 3300036712 Bacteria 4632
66 Ga0316584_0079483 3300036712 Bacteria 2457
67 Ga0316584_0155214 3300036712 Bacteria 1702
68 Ga0395905_0213413 3300037471 Bacteria 1808
69 Ga0451853_1011143 3300041512 Bacteria 1235
70 Ga0439449_0006946 3300042007 Bacteria 4315
71 Ga0466965_0075023 3300044683 Bacteria 1705
72 Ga0466970_0016159 3300044765 Bacteria 3844
73 Ga0495641_0034819 3300046461 Bacteria 2378
74 Ga0495651_0000416 3300046462 Bacteria 32979
75 Ga0495628_0015530 3300046516 Bacteria 6357
76 Ga0495652_0002078 3300046529 Bacteria 21147
77 Ga0495645_0036586 3300046543 Bacteria 3578
78 Ga0495600_0019579 3300046809 Bacteria 4324
79 Ga0495604_0080319 3300047317 Bacteria 2444
80 Ga0501036_0019187 3300049572 Bacteria 5737
81 Ga0501036_0086034 3300049572 Bacteria 2658
82 Ga0501039_0073728 3300049575 Bacteria 2652
83 Ga0501040_0019333 3300049576 Bacteria 4530
84 Ga0501041_0096562 3300049577 Bacteria 1827
85 Ga0501042_0017784 3300049578 Bacteria 4909
86 Ga0501067_0021931 3300049583 Bacteria 3534
87 Ga0501067_0033487 3300049583 Bacteria 2851
88 Ga0501067_0068239 3300049583 Bacteria 1968
89 Ga0501067_0152118 3300049583 Bacteria 1289
90 Ga0501068_0000604 3300049584 Bacteria 18272
91 Ga0501068_0007040 3300049584 Bacteria 6224
92 Ga0501068_0214635 3300049584 Bacteria 1222
93 Ga0501069_0000642 3300049585 Bacteria 16203
94 Ga0501069_0002724 3300049585 Bacteria 9021
95 Ga0501070_0021596 3300049586 Bacteria 5399
96 Ga0501070_0236197 3300049586 Bacteria 1497
97 Ga0501071_0009190 3300049587 Bacteria 6571
98 Ga0501071_0010943 3300049587 Bacteria 6089
99 Ga0501071_0105945 3300049587 Bacteria 2076
100 Ga0501071_0269389 3300049587 Bacteria 1287
101 Ga0501072_0000024 3300049588 Bacteria 143714
102 Ga0501072_0073427 3300049588 Bacteria 2704
103 Ga0501072_0172609 3300049588 Bacteria 1725
104 Ga0501073_0098334 3300049589 Bacteria 2032
105 Ga0501074_0011681 3300049590 Bacteria 6381
106 Ga0501076_0046868 3300049592 Bacteria 3416
107 Ga0501079_0028991 3300049741 Bacteria 4249
108 Ga0501079_0196921 3300049741 Bacteria 1573
109 Ga0501080_0043436 3300049742 Bacteria 4185
110 Ga0501083_0010467 3300049744 Bacteria 6530
111 Ga0501083_0015488 3300049744 Bacteria 5341
112 Ga0501044_0146378 3300049823 Bacteria 2347
113 nmdc:mga03n38_106584_c1 3300050490 Bacteria 1359
114 nmdc:mga06z11_117076_c1 3300050494 Bacteria 1482
115 nmdc:mga05p37_841496_c1 3300050507 Bacteria 998
116 nmdc:mga09592_73995_c1 3300050508 Bacteria 2895
117 nmdc:mga09592_8206_c1 3300050508 Bacteria 8490
118 nmdc:mga0qj67_279953_c1 3300050509 Bacteria 1352
119 nmdc:mga0qj67_283498_c1 3300050509 Bacteria 1343
120 nmdc:mga0qj67_85297_c1 3300050509 Bacteria 2533
121 nmdc:mga06r32_141560_c1 3300050510 Bacteria 2382
122 nmdc:mga06r32_174912_c1 3300050510 Bacteria 2131
123 nmdc:mga06r32_2804_c1 3300050510 Bacteria 15615
124 nmdc:mga08y16_12291_c1 3300050511 Bacteria 9001
125 Ga0495601_0056305 3300053077 Bacteria 2490
126 Ga0501084_0000041 3300054114 Bacteria 103074
127 Ga0501084_0043133 3300054114 Bacteria 3774
128 Ga0501082_0004250 3300060353 Bacteria 12509
129 Ga0501082_0218741 3300060353 Bacteria 1657
130 Ga0530510_0127700 3300061734 Bacteria 1869
131 2552108091 2551306166 Bacteria 9731570
132 2559424069 2558860280 Bacteria 11429938
133 2644514821 2643221692 Bacteria 7282860
134 2753071368 2751185734 Bacteria 8863695
135 2867348310 2867346516 Bacteria 7608576
136 2870721825 2870721527 Bacteria 9689237
137 2899373837 2899370129 Bacteria 6781179
138 3001891324 3001889506 Bacteria 2975194
139 Ga0316574_0063983
140 Ga0070658_10088828
141 Ga0070683_100208140
142 Ga0070668_100341523
143 Ga0070671_100007764
144 Ga0070714_100037585
145 Ga0068853_100145193
146 Ga0070665_100027883
147 Ga0068855_100009516
148 Ga0068854_100015623
149 Ga0068856_100017795
150 Ga0068860_100261172
151 Ga0081455_10000126
152 Ga0081539_10041489
153 Ga0075365_10085317
154 Ga0075365_10212118
155 Ga0075368_10034928
156 Ga0075363_100029418
157 Ga0075367_10040685
158 Ga0075367_10040840
159 Ga0075428_100317878
160 Ga0075430_100060155
161 Ga0075430_100222886
162 Ga0075431_100000382
163 Ga0075431_100186185
164 Ga0075429_100003659
165 Ga0105240_10006132
166 Ga0111539_10028036
167 Ga0111539_10030249
168 Ga0111539_10131530
169 Ga0114129_10147838
170 Ga0105243_10178332
171 Ga0105243_10222337
172 Ga0105241_10006595
173 Ga0105238_10050915
174 Ga0105238_10430910
175 Ga0105239_10056690
176 Ga0157380_10531566
177 Ga0157380_10607006
178 Ga0157377_10065514
179 Ga0157379_10074590
180 Ga0207647_10025808
181 Ga0207654_10015563
182 Ga0207695_10010569
183 Ga0207671_10000531
184 Ga0207694_10005816
185 Ga0207650_10151738
186 Ga0207664_10031197
187 Ga0207690_10139786
188 Ga0207640_10004187
189 Ga0207703_10092333
190 Ga0207698_10014048
191 Ga0268266_10023547
192 Ga0316576_10003375
193 Ga0316576_10051337
194 Ga0316576_10086000
195 Ga0307518_10174114
196 Ga0307409_100197236
197 Ga0307415_100012127
198 Ga0316583_10036694
199 Ga0307507_10179781
200 Ga0316574_0002484
201 Ga0316574_0004176
202 Ga0316574_0036552
203 Ga0316584_0022139
204 Ga0316584_0079483
205 Ga0316584_0155214
206 Ga0395905_0213413
207 Ga0451853_1011143
208 Ga0439449_0006946
209 Ga0466965_0075023
210 Ga0466970_0016159
211 Ga0495641_0034819
212 Ga0495651_0000416
213 Ga0495628_0015530
214 Ga0495652_0002078
215 Ga0495645_0036586
216 Ga0495600_0019579
217 Ga0495604_0080319
218 Ga0501036_0019187
219 Ga0501036_0086034
220 Ga0501039_0073728
221 Ga0501040_0019333
222 Ga0501041_0096562
223 Ga0501042_0017784
224 Ga0501067_0021931
225 Ga0501067_0033487
226 Ga0501067_0068239
227 Ga0501067_0152118
228 Ga0501068_0000604
229 Ga0501068_0007040
230 Ga0501068_0214635
231 Ga0501069_0000642
232 Ga0501069_0002724
233 Ga0501070_0021596
234 Ga0501070_0236197
235 Ga0501071_0009190
236 Ga0501071_0010943
237 Ga0501071_0105945
238 Ga0501071_0269389
239 Ga0501072_0000024
240 Ga0501072_0073427
241 Ga0501072_0172609
242 Ga0501073_0098334
243 Ga0501074_0011681
244 Ga0501076_0046868
245 Ga0501079_0028991
246 Ga0501079_0196921
247 Ga0501080_0043436
248 Ga0501083_0010467
249 Ga0501083_0015488
250 Ga0501044_0146378
251 nmdc:mga03n38_106584_c1
252 nmdc:mga06z11_117076_c1
253 nmdc:mga05p37_841496_c1
254 nmdc:mga09592_73995_c1
255 nmdc:mga09592_8206_c1
256 nmdc:mga0qj67_279953_c1
257 nmdc:mga0qj67_283498_c1
258 nmdc:mga0qj67_85297_c1
259 nmdc:mga06r32_141560_c1
260 nmdc:mga06r32_174912_c1
261 nmdc:mga06r32_2804_c1
262 nmdc:mga08y16_12291_c1
263 Ga0495601_0056305
264 Ga0501084_0000041
265 Ga0501084_0043133
266 Ga0501082_0004250
267 Ga0501082_0218741
268 Ga0530510_0127700
269 2552108091
270 2559424069
271 2644514821
272 2753071368
273 2867348310
274 2870721825
275 2899373837
276 3001891324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01068

DNA_ligase_A_M

ATP dependent DNA ligase domain

71

260

0.94

PF04679

DNA_ligase_A_C

ATP dependent DNA ligase C terminal region

277

392

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rpw-assembly1.cif.gz_E archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna 0.8214 3 201
6gdr-assembly1.cif.gz_A dna binding with a minimal scaffold: structure-function analysis of lig e dna ligases 0.7575 7 331
6gdr-assembly1.cif.gz_A dna binding with a minimal scaffold: structure-function analysis of lig e dna ligases 0.7469 7 331
6p0d-assembly1.cif.gz_A human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick 0.7364 3 340
6q1v-assembly1.cif.gz_A human dna ligase 1 (e592r) bound to an adenylated, hydroxyl terminated dna nick 0.7338 3 340
ID Description Score Start End Superfamily
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9775 3 200 3.30.470.30
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9726 3 200 3.30.470.30
2hixA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.862 3 200 3.30.470.30
4eq5A02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8558 3 199 3.30.470.30
af_P9WNV5_183_380_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8368 3 200 3.30.470.30
ID Description Score Start End GO Terms
AF-A0A534R9J8-F1-model_v4 ATP-dependent DNA ligase 0.9801 24 140 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A351EUR7-F1-model_v4 ATP-dependent DNA ligase 0.9745 7 120 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A536VNS5-F1-model_v4 ATP-dependent DNA ligase 0.9728 1 115 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A7Y5P5M4-F1-model_v4 deleted 0.9686 1 190
AF-X0TJE7-F1-model_v4 ATP-dependent DNA ligase family profile domain-containing protein 0.9675 1 179 GO:0003910
GO:0005524
GO:0006281
GO:0006310

Map