F173342

General Info

Members Datasets Scaffolds Average Seq Length
138 79 276 170

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10763031|Ga0207670_107630311
Length 167
Sequence MIRLRSSLVMMLAIWLPLGSAIAQESAAVLSGAELTRVVPTSFYFEGQSAPTQMRNAAAVRFAAKRFVIAGLVDTSGYSTDVQAKYQGFLITDSPVTIGGSELAVGAYGFGFSQDKLNIFDVGGNALLSISAAKDSSVKRPRPLMMTKAADGVRLYSGRNYVVIAAK

Samples

Sample ID Description Type Environment
1 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
75 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
76 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
77 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
78 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
79 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.28
Stem 0
Stem Tuber 0
Unclassified 40.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207670_10763031 3300025936 Unclassified 804
2 MBSR1b_contig_2793253 2162886012 Bacteria 877
3 Ga0065704_10289597 3300005289 Unclassified 906
4 Ga0065707_10006786 3300005295 Bacteria 4733
5 Ga0070690_100043296 3300005330 Unclassified 2855
6 Ga0068869_100014252 3300005334 Bacteria 5307
7 Ga0068869_100067761 3300005334 Bacteria 2634
8 Ga0070687_100420841 3300005343 Unclassified 881
9 Ga0070687_100544701 3300005343 Unclassified 788
10 Ga0070692_10071921 3300005345 Unclassified 1844
11 Ga0070669_100002620 3300005353 Bacteria 13006
12 Ga0070673_100028382 3300005364 Bacteria 4161
13 Ga0070705_100056151 3300005440 Bacteria 2317
14 Ga0070705_100223753 3300005440 Bacteria 1305
15 Ga0070705_100425847 3300005440 Unclassified 989
16 Ga0070700_100017051 3300005441 Unclassified 4147
17 Ga0070708_100038635 3300005445 Bacteria 4171
18 Ga0070708_100148865 3300005445 Unclassified 2176
19 Ga0070708_100448835 3300005445 Unclassified 1217
20 Ga0070708_101541835 3300005445 Unclassified 619
21 Ga0070678_100687180 3300005456 Unclassified 921
22 Ga0068867_100019837 3300005459 Unclassified 4791
23 Ga0070706_100043253 3300005467 Bacteria 4162
24 Ga0070706_100126237 3300005467 Unclassified 2386
25 Ga0070706_100143690 3300005467 Unclassified 2228
26 Ga0070706_100157299 3300005467 Bacteria 2121
27 Ga0070706_100209717 3300005467 Unclassified 1819
28 Ga0070706_100321778 3300005467 Unclassified 1442
29 Ga0070707_100078283 3300005468 Unclassified 3189
30 Ga0070707_100150992 3300005468 Bacteria 2262
31 Ga0070707_100453808 3300005468 Bacteria 1242
32 Ga0070698_100002793 3300005471 Bacteria 19229
33 Ga0070698_100077040 3300005471 Bacteria 3335
34 Ga0070698_100238991 3300005471 Bacteria 1750
35 Ga0070698_100936728 3300005471 Unclassified 812
36 Ga0070698_101874206 3300005471 Unclassified 552
37 Ga0070699_100011754 3300005518 Bacteria 7555
38 Ga0070699_100034208 3300005518 Bacteria 4392
39 Ga0070699_100097983 3300005518 Bacteria 2569
40 Ga0070699_100183284 3300005518 Unclassified 1859
41 Ga0070699_100479082 3300005518 Bacteria 1129
42 Ga0070697_100000366 3300005536 Bacteria 35335
43 Ga0070697_100002473 3300005536 Bacteria 14208
44 Ga0070697_100012187 3300005536 Bacteria 6734
45 Ga0070697_100020885 3300005536 Bacteria 5184
46 Ga0070697_100040032 3300005536 Unclassified 3791
47 Ga0070697_101338203 3300005536 Unclassified 639
48 Ga0070672_100094730 3300005543 Unclassified 2414
49 Ga0070686_100468157 3300005544 Unclassified 972
50 Ga0070695_100158374 3300005545 Bacteria 1587
51 Ga0070695_100283986 3300005545 Bacteria 1217
52 Ga0070696_100094145 3300005546 Unclassified 2137
53 Ga0070696_100120054 3300005546 Bacteria 1902
54 Ga0070696_100209707 3300005546 Bacteria 1458
55 Ga0070704_100039489 3300005549 Bacteria 3241
56 Ga0070704_100187882 3300005549 Bacteria 1658
57 Ga0068852_101337371 3300005616 Bacteria 738
58 Ga0068859_100499982 3300005617 Bacteria 1311
59 Ga0068864_100833302 3300005618 Bacteria 908
60 Ga0068861_100014733 3300005719 Bacteria 5492
61 Ga0068858_101028283 3300005842 Unclassified 808
62 Ga0068862_100020586 3300005844 Bacteria 5510
63 Ga0068862_101491879 3300005844 Unclassified 681
64 Ga0081539_10001905 3300005985 Bacteria 32324
65 Ga0081539_10050073 3300005985 Bacteria 2366
66 Ga0075430_100730531 3300006846 Bacteria 816
67 Ga0075431_100559197 3300006847 Unclassified 1131
68 Ga0075433_10833748 3300006852 Bacteria 805
69 Ga0075434_100268781 3300006871 Bacteria 1725
70 Ga0075434_100441438 3300006871 Bacteria 1323
71 Ga0097620_100500022 3300006931 Bacteria 1311
72 Ga0075435_100102280 3300007076 Bacteria 2375
73 Ga0075435_100218853 3300007076 Bacteria 1617
74 Ga0099794_10028015 3300007265 Bacteria 2617
75 Ga0099794_10096564 3300007265 Bacteria 1471
76 Ga0099794_10276325 3300007265 Unclassified 868
77 Ga0111539_10005719 3300009094 Bacteria 16078
78 Ga0114129_10009735 3300009147 Bacteria 13709
79 Ga0114129_10062961 3300009147 Bacteria 5181
80 Ga0114129_10417737 3300009147 Bacteria 1765
81 Ga0114129_10523140 3300009147 Bacteria 1546
82 Ga0114129_10662104 3300009147 Bacteria 1346
83 Ga0105243_10663994 3300009148 Unclassified 1012
84 Ga0105241_10991881 3300009174 Unclassified 785
85 Ga0105242_10478462 3300009176 Bacteria 1180
86 Ga0105242_11031811 3300009176 Bacteria 832
87 Ga0105249_10005471 3300009553 Bacteria 10966
88 Ga0105239_10072932 3300010375 Bacteria 3775
89 Ga0105246_10993803 3300011119 Bacteria 759
90 Ga0157378_10346494 3300013297 Unclassified 1450
91 Ga0163162_10406049 3300013306 Unclassified 1495
92 Ga0163162_10717953 3300013306 Unclassified 1120
93 Ga0157375_10033924 3300013308 Unclassified 4856
94 Ga0163163_10013746 3300014325 Bacteria 7419
95 Ga0157380_10027176 3300014326 Unclassified 4350
96 Ga0207653_10000477 3300025885 Bacteria 15848
97 Ga0207653_10033184 3300025885 Bacteria 1673
98 Ga0207653_10091460 3300025885 Unclassified 1066
99 Ga0207684_10011336 3300025910 Bacteria 7802
100 Ga0207684_10068114 3300025910 Bacteria 3025
101 Ga0207684_10073466 3300025910 Unclassified 2904
102 Ga0207684_10073500 3300025910 Bacteria 2904
103 Ga0207684_10134442 3300025910 Bacteria 2123
104 Ga0207684_10370383 3300025910 Bacteria 1232
105 Ga0207684_10387098 3300025910 Unclassified 1202
106 Ga0207684_10511677 3300025910 Unclassified 1029
107 Ga0207662_10407101 3300025918 Unclassified 923
108 Ga0207662_10543162 3300025918 Unclassified 804
109 Ga0207646_10051599 3300025922 Bacteria 3680
110 Ga0207646_10137381 3300025922 Bacteria 2201
111 Ga0207681_10049642 3300025923 Unclassified 2837
112 Ga0207709_10527448 3300025935 Unclassified 925
113 Ga0207665_10949612 3300025939 Unclassified 683
114 Ga0207691_10328654 3300025940 Unclassified 1310
115 Ga0207689_10027231 3300025942 Bacteria 4786
116 Ga0207689_10245089 3300025942 Bacteria 1482
117 Ga0207651_10020389 3300025960 Bacteria 4000
118 Ga0207712_10550955 3300025961 Unclassified 992
119 Ga0207703_11407596 3300026035 Bacteria 671
120 Ga0207708_10020539 3300026075 Bacteria 4981
121 Ga0207648_10068324 3300026089 Unclassified 3096
122 Ga0207675_100009883 3300026118 Bacteria 8926
123 Ga0207675_100263108 3300026118 Bacteria 1672
124 Ga0207675_100353596 3300026118 Bacteria 1440
125 Ga0207683_10711478 3300026121 Unclassified 931
126 Ga0209588_1033983 3300027671 Bacteria 1636
127 Ga0268265_10754262 3300028380 Unclassified 945
128 Ga0307513_10825511 3300031456 Bacteria 633
129 Ga0439444_0020939 3300042437 Unclassified 1155
130 Ga0453683_0228814 3300044673 Unclassified 1183
131 Ga0495584_0202097 3300046491 Bacteria 1010
132 nmdc:mga05p37_244731_c1 3300050507 Bacteria 2154
133 nmdc:mga05p37_291539_c1 3300050507 Unclassified 1942
134 nmdc:mga05p37_54734_c1 3300050507 Unclassified 4908
135 nmdc:mga08y16_14640_c1 3300050511 Bacteria 8248
136 nmdc:mga0n895_409948_c1 3300050512 Bacteria 1370
137 nmdc:mga0a205_143836_c1 3300050515 Bacteria 2285
138 Ga0530510_0414808 3300061734 Unclassified 1016
139 Ga0207670_10763031
140 MBSR1b_contig_2793253
141 Ga0065704_10289597
142 Ga0065707_10006786
143 Ga0070690_100043296
144 Ga0068869_100014252
145 Ga0068869_100067761
146 Ga0070687_100420841
147 Ga0070687_100544701
148 Ga0070692_10071921
149 Ga0070669_100002620
150 Ga0070673_100028382
151 Ga0070705_100056151
152 Ga0070705_100223753
153 Ga0070705_100425847
154 Ga0070700_100017051
155 Ga0070708_100038635
156 Ga0070708_100148865
157 Ga0070708_100448835
158 Ga0070708_101541835
159 Ga0070678_100687180
160 Ga0068867_100019837
161 Ga0070706_100043253
162 Ga0070706_100126237
163 Ga0070706_100143690
164 Ga0070706_100157299
165 Ga0070706_100209717
166 Ga0070706_100321778
167 Ga0070707_100078283
168 Ga0070707_100150992
169 Ga0070707_100453808
170 Ga0070698_100002793
171 Ga0070698_100077040
172 Ga0070698_100238991
173 Ga0070698_100936728
174 Ga0070698_101874206
175 Ga0070699_100011754
176 Ga0070699_100034208
177 Ga0070699_100097983
178 Ga0070699_100183284
179 Ga0070699_100479082
180 Ga0070697_100000366
181 Ga0070697_100002473
182 Ga0070697_100012187
183 Ga0070697_100020885
184 Ga0070697_100040032
185 Ga0070697_101338203
186 Ga0070672_100094730
187 Ga0070686_100468157
188 Ga0070695_100158374
189 Ga0070695_100283986
190 Ga0070696_100094145
191 Ga0070696_100120054
192 Ga0070696_100209707
193 Ga0070704_100039489
194 Ga0070704_100187882
195 Ga0068852_101337371
196 Ga0068859_100499982
197 Ga0068864_100833302
198 Ga0068861_100014733
199 Ga0068858_101028283
200 Ga0068862_100020586
201 Ga0068862_101491879
202 Ga0081539_10001905
203 Ga0081539_10050073
204 Ga0075430_100730531
205 Ga0075431_100559197
206 Ga0075433_10833748
207 Ga0075434_100268781
208 Ga0075434_100441438
209 Ga0097620_100500022
210 Ga0075435_100102280
211 Ga0075435_100218853
212 Ga0099794_10028015
213 Ga0099794_10096564
214 Ga0099794_10276325
215 Ga0111539_10005719
216 Ga0114129_10009735
217 Ga0114129_10062961
218 Ga0114129_10417737
219 Ga0114129_10523140
220 Ga0114129_10662104
221 Ga0105243_10663994
222 Ga0105241_10991881
223 Ga0105242_10478462
224 Ga0105242_11031811
225 Ga0105249_10005471
226 Ga0105239_10072932
227 Ga0105246_10993803
228 Ga0157378_10346494
229 Ga0163162_10406049
230 Ga0163162_10717953
231 Ga0157375_10033924
232 Ga0163163_10013746
233 Ga0157380_10027176
234 Ga0207653_10000477
235 Ga0207653_10033184
236 Ga0207653_10091460
237 Ga0207684_10011336
238 Ga0207684_10068114
239 Ga0207684_10073466
240 Ga0207684_10073500
241 Ga0207684_10134442
242 Ga0207684_10370383
243 Ga0207684_10387098
244 Ga0207684_10511677
245 Ga0207662_10407101
246 Ga0207662_10543162
247 Ga0207646_10051599
248 Ga0207646_10137381
249 Ga0207681_10049642
250 Ga0207709_10527448
251 Ga0207665_10949612
252 Ga0207691_10328654
253 Ga0207689_10027231
254 Ga0207689_10245089
255 Ga0207651_10020389
256 Ga0207712_10550955
257 Ga0207703_11407596
258 Ga0207708_10020539
259 Ga0207648_10068324
260 Ga0207675_100009883
261 Ga0207675_100263108
262 Ga0207675_100353596
263 Ga0207683_10711478
264 Ga0209588_1033983
265 Ga0268265_10754262
266 Ga0307513_10825511
267 Ga0439444_0020939
268 Ga0453683_0228814
269 Ga0495584_0202097
270 nmdc:mga05p37_244731_c1
271 nmdc:mga05p37_291539_c1
272 nmdc:mga05p37_54734_c1
273 nmdc:mga08y16_14640_c1
274 nmdc:mga0n895_409948_c1
275 nmdc:mga0a205_143836_c1
276 Ga0530510_0414808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dm4-assembly1.cif.gz_B crystal structure of the sh2 domain from ravo (lpg1129) from legionella pneumophila in complex with homo sapiens shc1 phospho-tyr317 peptide 0.5726 71 131
6tjb-assembly1.cif.gz_D crystal structure of the computationally designed cake2 protein 0.5579 105 165
4uzr-assembly1.cif.gz_B crystal structure of pyrococcus horikoshii ph1500 0.527 100 165
2m3x-assembly1.cif.gz_A solution structure of ph1500: a homohexameric protein centered on a 12-bladed beta-propeller 0.516 105 155
3bqb-assembly1.cif.gz_X hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.4826 92 119
ID Description Score Start End Superfamily
af_Q9W040_2_135_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5491 105 153 2.130.10.10
2m3xC02 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.5419 105 165 2.40.10.360
af_A0A0P0WS15_885_954_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.5179 105 160 2.40.10.480
af_I1J9S9_3_89_2.90.10.10 Mainly Beta;Orthogonal Prism;Agglutinin, subunit A;Bulb-type lectin domain 0.5052 102 163 2.90.10.10
af_Q6EUK6_90_180_2.90.10.10 Mainly Beta;Orthogonal Prism;Agglutinin, subunit A;Bulb-type lectin domain 0.5021 86 127 2.90.10.10
ID Description Score Start End GO Terms
AF-A0A2V8NBL5-F1-model_v4 Uncharacterized protein 0.9795 20 165
AF-A0A7Y2D4W5-F1-model_v4 6-bladed beta-propeller 0.9677 16 165
AF-A0A2V8NBL5-F1-model_v4 Uncharacterized protein 0.96 20 165
AF-A0A352EZ61-F1-model_v4 Uncharacterized protein 0.9481 52 165
AF-A0A1H5WMK1-F1-model_v4 Uncharacterized protein 0.9469 36 165

Map