F171549

General Info

Members Datasets Scaffolds Average Seq Length
137 101 125 274

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2945991243|2945993625
Length 322
Sequence SLGLLFKNRYLINYTYIFYQNEFYYIYKETNVIYDECMNTKTNIKRVHEMQDIKRKIQEAAQFIEKEIDCRPEIGLILGSGLGILADLIENAKVIPYESIPHFPMSTVEGHAGELVFGQINNKSVVMMKGRFHLYEGYEAQHVTLPVRILKALGISQLIVTNAAGGVNADYEVGDLMLITDHINNMGRNPLIGPNEKDFGERFPDMSEAYSKRLIQIAQRVAEKQQYSFREGIYMGNLGPTYETPAEVRMARILGADAVGMSTIPEVIVARHAGMEVLGISCITNKAAGLLQQALSHEEVMEAAEQVKPKFLKLVLEIIKEM

Samples

Sample ID Description Type Environment
1 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
2 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
3 2857472729 Cohnella sp. R-74144 Isolate Unclassified
4 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
5 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
6 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
7 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
8 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
9 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
10 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
11 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
42 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
43 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
44 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
45 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
50 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
51 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
52 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
53 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
57 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
58 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
59 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
60 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
61 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
62 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
63 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
64 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
65 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
68 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
69 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
70 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
71 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
72 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
73 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
74 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
91 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
92 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
95 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
99 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
100 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
101 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.05
Metatranscriptomes 2.19
Isolates 8.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.11
Nodule 0
Rhizoplane 0
Rhizosphere 77.37
Stem 0
Stem Tuber 0
Unclassified 17.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055535_1007190 3300003761 Bacteria 2153
2 Ga0070658_10143124 3300005327 Bacteria 1998
3 Ga0070669_100002138 3300005353 Bacteria 14290
4 Ga0070675_100125786 3300005354 Bacteria 2181
5 Ga0070673_100500672 3300005364 Bacteria 1099
6 Ga0070678_100112076 3300005456 Bacteria 2136
7 Ga0068859_100010535 3300005617 Bacteria 9306
8 Ga0068871_100306799 3300006358 Bacteria 1394
9 Ga0075431_100304618 3300006847 Bacteria 1609
10 Ga0097620_100010535 3300006931 Bacteria 9306
11 Ga0105245_10000015 3300009098 Bacteria 224549
12 Ga0157375_10000007 3300013308 Bacteria 377743
13 Ga0157380_10021490 3300014326 Bacteria 4841
14 Ga0157380_10102781 3300014326 Bacteria 2383
15 Ga0157376_10253969 3300014969 Bacteria 1643
16 Ga0209566_100015 3300025225 Bacteria 457963
17 Ga0209258_101093 3300025242 Bacteria 11558
18 Ga0209676_1004460 3300025292 Bacteria 7785
19 Ga0209025_1007060 3300025294 Bacteria 8503
20 Ga0209025_1007922 3300025294 Bacteria 7777
21 Ga0209025_1048858 3300025294 Bacteria 1710
22 Ga0207643_10088777 3300025908 Bacteria 1800
23 Ga0207643_10116429 3300025908 Bacteria 1579
24 Ga0207705_10093635 3300025909 Bacteria 2203
25 Ga0207660_10330654 3300025917 Bacteria 1218
26 Ga0207659_10178440 3300025926 Bacteria 1681
27 Ga0207687_10000089 3300025927 Bacteria 66709
28 Ga0207668_10249885 3300025972 Bacteria 1440
29 Ga0207639_10098116 3300026041 Bacteria 2361
30 Ga0207676_10142040 3300026095 Bacteria 2057
31 Ga0207683_10113877 3300026121 Bacteria 2423
32 Ga0207428_10009079 3300027907 Bacteria 8939
33 Ga0268265_10130872 3300028380 Bacteria 2085
34 Ga0265334_10023114 3300028573 Unclassified 2530
35 Ga0265340_10001281 3300031247 Bacteria 14415
36 Ga0265313_10063147 3300031595 Bacteria 1728
37 Ga0316575_10056611 3300031665 Bacteria 1562
38 Ga0316579_10001064 3300031691 Bacteria 9712
39 Ga0316576_10000352 3300031727 Bacteria 20696
40 Ga0316576_10013992 3300031727 Bacteria 5351
41 Ga0316576_10049286 3300031727 Unclassified 3058
42 Ga0316576_10064252 3300031727 Bacteria 2695
43 Ga0316578_10013466 3300031728 Unclassified 4340
44 Ga0316578_10046228 3300031728 Unclassified 2536
45 Ga0307516_10005317 3300031730 Bacteria 15489
46 Ga0316577_10052859 3300031733 Bacteria 2267
47 Ga0316577_10093893 3300031733 Unclassified 1680
48 Ga0316583_10001126 3300032133 Bacteria 8736
49 Ga0316585_10003149 3300032137 Unclassified 4503
50 Ga0316585_10007733 3300032137 Unclassified 3105
51 Ga0316580_10001753 3300032139 Bacteria 5795
52 Ga0316580_10045063 3300032139 Bacteria 1360
53 Ga0316592_1004595 3300033524 Unclassified 2576
54 Ga0316588_1002984 3300033528 Unclassified 3023
55 Ga0316596_1003823 3300033541 Unclassified 3331
56 Ga0316574_0000222 3300035398 Bacteria 20283
57 Ga0316574_0000733 3300035398 Bacteria 14064
58 Ga0316574_0003562 3300035398 Bacteria 8047
59 Ga0316574_0038373 3300035398 Bacteria 2940
60 Ga0316582_0001275 3300036647 Bacteria 10882
61 Ga0316582_0004470 3300036647 Bacteria 7079
62 Ga0316582_0005954 3300036647 Bacteria 6349
63 Ga0316582_0010654 3300036647 Bacteria 5043
64 Ga0316582_0086567 3300036647 Bacteria 2055
65 Ga0316584_0002583 3300036712 Bacteria 11510
66 Ga0316584_0004735 3300036712 Bacteria 9017
67 Ga0316584_0027174 3300036712 Unclassified 4210
68 Ga0316584_0147953 3300036712 Bacteria 1750
69 Ga0316584_0153465 3300036712 Unclassified 1713
70 Ga0316584_0409663 3300036712 Bacteria 964
71 Ga0316581_0001045 3300037588 Bacteria 5951
72 Ga0316581_0001617 3300037588 Bacteria 5141
73 Ga0316581_0071863 3300037588 Bacteria 1063
74 Ga0400484_08585 3300038725 Bacteria 4903
75 Ga0400484_23888 3300038725 Bacteria 2372
76 Ga0400484_42205 3300038725 Unclassified 3960
77 Ga0400490_00982 3300038726 Bacteria 5712
78 Ga0400490_06782 3300038726 Archaea 2304
79 Ga0400490_28215 3300038726 Bacteria 5559
80 Ga0400490_38215 3300038726 Unclassified 4045
81 Ga0400491_18844 3300038727 Bacteria 3599
82 Ga0400488_17673 3300038741 Bacteria 4007
83 Ga0400488_23357 3300038741 Unclassified 2342
84 Ga0400487_24580 3300039110 Bacteria 7563
85 Ga0400487_37018 3300039110 Unclassified 1817
86 Ga0451855_1015858 3300041511 Bacteria 962
87 Ga0453684_0171084 3300044712 Unclassified 2560
88 Ga0466958_0125879 3300045836 Bacteria 1607
89 Ga0495590_0078527 3300046457 Bacteria 1162
90 Ga0495650_0008390 3300046471 Bacteria 6037
91 Ga0495660_0053011 3300046810 Bacteria 2203
92 Ga0495602_0220563 3300048088 Bacteria 1432
93 Ga0496116_0164327 3300048919 Bacteria 1213
94 Ga0496122_0000019 3300048925 Bacteria 411199
95 Ga0496122_0044487 3300048925 Bacteria 3464
96 Ga0496123_0017530 3300048926 Bacteria 5754
97 Ga0496126_0003900 3300048929 Bacteria 18337
98 Ga0501033_0007271 3300049570 Bacteria 8635
99 Ga0501036_0020138 3300049572 Bacteria 5602
100 Ga0501037_0164030 3300049573 Bacteria 1583
101 Ga0501038_0188125 3300049574 Bacteria 1663
102 Ga0501039_0025609 3300049575 Bacteria 4534
103 Ga0501040_0015680 3300049576 Bacteria 5009
104 Ga0501041_0016446 3300049577 Bacteria 4397
105 Ga0501042_0033954 3300049578 Bacteria 3617
106 Ga0501043_0017070 3300049579 Bacteria 5692
107 Ga0501046_0068563 3300049580 Bacteria 2760
108 Ga0501070_0025804 3300049586 Bacteria 4930
109 Ga0501071_0054339 3300049587 Bacteria 2890
110 Ga0501072_0008761 3300049588 Bacteria 7681
111 Ga0501074_0237357 3300049590 Bacteria 1297
112 Ga0501075_0117752 3300049591 Bacteria 2019
113 Ga0501076_0013685 3300049592 Bacteria 6086
114 Ga0501077_0087081 3300049593 Bacteria 1980
115 Ga0501079_0002298 3300049741 Bacteria 13824
116 Ga0501079_0176380 3300049741 Bacteria 1667
117 Ga0501081_0003554 3300049743 Bacteria 9957
118 Ga0501045_0003058 3300049824 Bacteria 11440
119 nmdc:mga06r32_126773_c1 3300050510 Bacteria 2522
120 nmdc:mga08y16_426831_c1 3300050511 Unclassified 1354
121 nmdc:mga08y16_4472_c1 3300050511 Bacteria 14607
122 Ga0501084_0010855 3300054114 Bacteria 7544
123 Ga0501084_0040831 3300054114 Bacteria 3882
124 Ga0501082_0001580 3300060353 Bacteria 20090
125 Ga0530510_0014654 3300061734 Bacteria 5534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10143124 Ga0070658_101431242 233
2 3300013308 Ga0157375_10000007 Ga0157375_10000007260 233
3 3300025909 Ga0207705_10093635 Ga0207705_100936352 233
4 3300025917 Ga0207660_10330654 Ga0207660_103306542 233
5 3300036647 Ga0316582_0005954 Ga0316582_0005954_1009_1734 238
6 3300049573 Ga0501037_0164030 Ga0501037_0164030_31_771 246
7 3300028573 Ga0265334_10023114 Ga0265334_100231142 251
8 3300005353 Ga0070669_100002138 Ga0070669_1000021385 259
9 3300005354 Ga0070675_100125786 Ga0070675_1001257862 259
10 3300005364 Ga0070673_100500672 Ga0070673_1005006721 259
11 3300014326 Ga0157380_10102781 Ga0157380_101027812 259
12 3300025908 Ga0207643_10088777 Ga0207643_100887771 259
13 3300025926 Ga0207659_10178440 Ga0207659_101784402 259
14 3300026041 Ga0207639_10098116 Ga0207639_100981162 259
15 3300027907 Ga0207428_10009079 Ga0207428_100090793 259
16 3300028380 Ga0268265_10130872 Ga0268265_101308723 259
17 3300049741 Ga0501079_0176380 Ga0501079_0176380_614_1447 259
18 3300050511 nmdc:mga08y16_4472_c1 nmdc:mga08y16_4472_c1_12128_12958 259
19 3300054114 Ga0501084_0040831 Ga0501084_0040831_1278_2108 259
20 3300036647 Ga0316582_0004470 Ga0316582_0004470_5434_6267 260
21 3300048919 Ga0496116_0164327 Ga0496116_0164327_176_1039 261
22 3300046471 Ga0495650_0008390 Ga0495650_0008390_1130_1993 262
23 3300031727 Ga0316576_10000352 Ga0316576_100003526 263
24 3300032133 Ga0316583_10001126 Ga0316583_100011267 263
25 3300032137 Ga0316585_10007733 Ga0316585_100077334 263
26 3300032139 Ga0316580_10001753 Ga0316580_100017532 263
27 3300033524 Ga0316592_1004595 Ga0316592_10045952 263
28 3300033528 Ga0316588_1002984 Ga0316588_10029842 263
29 3300033541 Ga0316596_1003823 Ga0316596_10038234 263
30 3300035398 Ga0316574_0000222 Ga0316574_0000222_9024_9869 263
31 3300036647 Ga0316582_0010654 Ga0316582_0010654_699_1544 263
32 3300036712 Ga0316584_0153465 Ga0316584_0153465_148_993 263
33 3300037588 Ga0316581_0001617 Ga0316581_0001617_1549_2394 263
34 3300025294 Ga0209025_1048858 Ga0209025_10488582 265
35 3300014969 Ga0157376_10253969 Ga0157376_102539692 266
36 3300046457 Ga0495590_0078527 Ga0495590_0078527_189_1055 266
37 3300046810 Ga0495660_0053011 Ga0495660_0053011_1199_2065 266
38 iso_pu_bacteria 3006969106 3006972877 266
39 iso_pu_bacteria 2857604169 2857604230 267
40 3300014326 Ga0157380_10021490 Ga0157380_100214904 268
41 iso_pu_bacteria 2831905167 2831905734 268
42 iso_pu_bacteria 2585428059 2587739374 269
43 iso_pu_bacteria 2857472729 2857473745 269
44 iso_pu_bacteria 2889049205 2889050221 269
45 iso_pu_bacteria 2904755435 2904759129 269
46 3300006358 Ga0068871_100306799 Ga0068871_1003067991 270
47 3300006847 Ga0075431_100304618 Ga0075431_1003046182 270
48 3300050510 nmdc:mga06r32_126773_c1 nmdc:mga06r32_126773_c1_1251_2087 270
49 iso_pu_bacteria 2925326138 2925331647 271
50 iso_pu_bacteria 2929206907 2929211803 271
51 iso_pu_bacteria 8057733483 8057733511 271
52 3300005617 Ga0068859_100010535 Ga0068859_1000105359 272
53 3300006931 Ga0097620_100010535 Ga0097620_1000105359 272
54 3300009098 Ga0105245_10000015 Ga0105245_1000001596 272
55 3300025927 Ga0207687_10000089 Ga0207687_100000893 272
56 3300025972 Ga0207668_10249885 Ga0207668_102498851 272
57 3300026095 Ga0207676_10142040 Ga0207676_101420403 272
58 3300031730 Ga0307516_10005317 Ga0307516_100053173 272
59 3300045836 Ga0466958_0125879 Ga0466958_0125879_510_1334 272
60 3300048925 Ga0496122_0044487 Ga0496122_0044487_2257_3075 272
61 3300049570 Ga0501033_0007271 Ga0501033_0007271_7491_8315 272
62 3300049572 Ga0501036_0020138 Ga0501036_0020138_4521_5345 272
63 3300049574 Ga0501038_0188125 Ga0501038_0188125_620_1444 272
64 3300049575 Ga0501039_0025609 Ga0501039_0025609_2766_3590 272
65 3300049576 Ga0501040_0015680 Ga0501040_0015680_1001_1825 272
66 3300049577 Ga0501041_0016446 Ga0501041_0016446_258_1082 272
67 3300049578 Ga0501042_0033954 Ga0501042_0033954_2205_3029 272
68 3300049579 Ga0501043_0017070 Ga0501043_0017070_4545_5369 272
69 3300049580 Ga0501046_0068563 Ga0501046_0068563_1280_2104 272
70 3300049587 Ga0501071_0054339 Ga0501071_0054339_2010_2834 272
71 3300049588 Ga0501072_0008761 Ga0501072_0008761_2378_3202 272
72 3300049590 Ga0501074_0237357 Ga0501074_0237357_36_860 272
73 3300049591 Ga0501075_0117752 Ga0501075_0117752_1020_1844 272
74 3300049592 Ga0501076_0013685 Ga0501076_0013685_2445_3269 272
75 3300049593 Ga0501077_0087081 Ga0501077_0087081_664_1488 272
76 3300049741 Ga0501079_0002298 Ga0501079_0002298_10710_11534 272
77 3300049743 Ga0501081_0003554 Ga0501081_0003554_6071_6895 272
78 3300049824 Ga0501045_0003058 Ga0501045_0003058_4547_5371 272
79 3300054114 Ga0501084_0010855 Ga0501084_0010855_2693_3517 272
80 3300060353 Ga0501082_0001580 Ga0501082_0001580_7900_8724 272
81 3300061734 Ga0530510_0014654 Ga0530510_0014654_2784_3608 272
82 3300025292 Ga0209676_1004460 Ga0209676_10044609 273
83 3300031247 Ga0265340_10001281 Ga0265340_100012815 273
84 3300048925 Ga0496122_0000019 Ga0496122_0000019_293742_294575 273
85 3300048926 Ga0496123_0017530 Ga0496123_0017530_2137_2970 273
86 3300048929 Ga0496126_0003900 Ga0496126_0003900_967_1800 273
87 3300049586 Ga0501070_0025804 Ga0501070_0025804_3324_4166 273
88 3300025908 Ga0207643_10116429 Ga0207643_101164292 274
89 3300031733 Ga0316577_10052859 Ga0316577_100528592 274
90 3300037588 Ga0316581_0071863 Ga0316581_0071863_96_929 274
91 3300005456 Ga0070678_100112076 Ga0070678_1001120763 275
92 3300025225 Ga0209566_100015 Ga0209566_100015240 275
93 3300026121 Ga0207683_10113877 Ga0207683_101138773 275
94 3300031665 Ga0316575_10056611 Ga0316575_100566112 275
95 3300031691 Ga0316579_10001064 Ga0316579_100010644 275
96 3300031727 Ga0316576_10013992 Ga0316576_100139922 275
97 3300031727 Ga0316576_10049286 Ga0316576_100492864 275
98 3300031727 Ga0316576_10064252 Ga0316576_100642522 275
99 3300031728 Ga0316578_10013466 Ga0316578_100134662 275
100 3300031728 Ga0316578_10046228 Ga0316578_100462283 275
101 3300031733 Ga0316577_10093893 Ga0316577_100938932 275
102 3300032137 Ga0316585_10003149 Ga0316585_100031492 275
103 3300032139 Ga0316580_10045063 Ga0316580_100450632 275
104 3300035398 Ga0316574_0000733 Ga0316574_0000733_4618_5454 275
105 3300035398 Ga0316574_0003562 Ga0316574_0003562_6178_7014 275
106 3300035398 Ga0316574_0038373 Ga0316574_0038373_430_1275 275
107 3300036647 Ga0316582_0001275 Ga0316582_0001275_6215_7051 275
108 3300036647 Ga0316582_0086567 Ga0316582_0086567_644_1489 275
109 3300036712 Ga0316584_0002583 Ga0316584_0002583_1331_2167 275
110 3300036712 Ga0316584_0004735 Ga0316584_0004735_7129_7974 275
111 3300036712 Ga0316584_0027174 Ga0316584_0027174_1811_2656 275
112 3300037588 Ga0316581_0001045 Ga0316581_0001045_1222_2058 275
113 3300038725 Ga0400484_42205 Ga0400484_42205_3081_3923 275
114 3300038726 Ga0400490_38215 Ga0400490_38215_1916_2758 275
115 3300041511 Ga0451855_1015858 Ga0451855_1015858_39_887 275
116 iso_pu_bacteria 2904113452 2904118225 275
117 3300031595 Ga0265313_10063147 Ga0265313_100631472 276
118 3300048088 Ga0495602_0220563 Ga0495602_0220563_344_1204 276
119 3300050511 nmdc:mga08y16_426831_c1 nmdc:mga08y16_426831_c1_196_1026 276
120 3300036712 Ga0316584_0147953 Ga0316584_0147953_523_1380 277
121 3300036712 Ga0316584_0409663 Ga0316584_0409663_32_880 277
122 3300038725 Ga0400484_23888 Ga0400484_23888_568_1419 278
123 3300038726 Ga0400490_00982 Ga0400490_00982_2673_3509 278
124 3300038741 Ga0400488_23357 Ga0400488_23357_297_1163 282
125 3300038725 Ga0400484_08585 Ga0400484_08585_3419_4273 284
126 3300038726 Ga0400490_06782 Ga0400490_06782_878_1732 284
127 3300038726 Ga0400490_28215 Ga0400490_28215_1592_2446 284
128 3300038727 Ga0400491_18844 Ga0400491_18844_2322_3176 284
129 3300038741 Ga0400488_17673 Ga0400488_17673_858_1712 284
130 3300039110 Ga0400487_37018 Ga0400487_37018_291_1148 284
131 3300044712 Ga0453684_0171084 Ga0453684_0171084_142_1023 287
132 3300025294 Ga0209025_1007922 Ga0209025_10079226 292
133 3300039110 Ga0400487_24580 Ga0400487_24580_946_1896 300
134 iso_pu_bacteria 2945991243 2945993625 303
135 3300003761 Ga0055535_1007190 Ga0055535_10071902 304
136 3300025242 Ga0209258_101093 Ga0209258_1010935 304
137 3300025294 Ga0209025_1007060 Ga0209025_10070606 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

73

320

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8swu-assembly1.cif.gz_A structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate 0.9884 37 304
8swu-assembly1.cif.gz_B structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate 0.9872 37 304
6tk9-assembly1.cif.gz_B purine-nucleoside phosphorylase from thermus thermophilus 0.984 36 304
4m1e-assembly1.cif.gz_B crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364. 0.9801 37 302
8swu-assembly1.cif.gz_C structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate 0.9786 33 304
ID Description Score Start End Superfamily
1vmkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9701 35 304 3.40.50.1580
1yqqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9693 33 302 3.40.50.1580
af_U4PSA1_35_317_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.967 35 304 3.40.50.1580
1vmkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9662 35 304 3.40.50.1580
4lnaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.966 35 298 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A090ZGX3-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9988 39 304 GO:0004731
GO:0005737
GO:0009116
AF-A0A1I2EJ84-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9979 32 304 GO:0004731
GO:0005737
GO:0009116
AF-A0A450ASY5-F1-model_v4 deleted 0.9967 35 304
AF-A0A4R5VPG9-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9966 34 300 GO:0004731
GO:0005737
GO:0009116
AF-A0A223E9K2-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9965 37 304 GO:0004731
GO:0005737
GO:0009116

Feature Viewer

pLDDT pTM Quality
88.39 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map