F171195

General Info

Members Datasets Scaffolds Average Seq Length
137 104 116 400

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0109816|Ga0501036_0109816_14_1345
Length 443
Sequence MPSGLGDVGRPVREPATVVDATTPTTGDPTAPPCPAARPRLALFALALGGFAIGTTEFVTMGLLPEVAAGVGISIPTAGHVVSAYAAGVVVGAPVLAALGARVPRKTMLLWLMAAFAAANLASALATTYPGLMAARFASGLPHGAFFGLGALVAASMVPFHRRTWAVSMMLVGLTVANVVGVPLTTKLGQDLGWQWPYAAVGLIALLTVTAVWRWVPFHAVTGEASVRAELRALHRPQVWLALGIGTVGFGGMFATYAYISPTVTGLTGLEPAAIPLVLALYGIGMTVGALLSGRVARGGLLRGIILVLGAIAVMLALFGFAAHQPALALLWVFLLGLLPSILVPMLQTRLMDVAHEGQSLAAALNHSTLNIANALGAWLGSVVLAAGLGYEWPSRVGALLAVLGVGIAVVSALAERAADRRQPAVTAEAPVATAGSGYSRAV

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221576 Nocardioides sp. Root614 Isolate Unclassified
4 2643221590 Nocardioides sp. Root682 Isolate Unclassified
5 2643221604 Nocardioides sp. Root190 Isolate Unclassified
6 2643221617 Nocardioides sp. Root79 Isolate Unclassified
7 2643221620 Nocardioides sp. Root240 Isolate Unclassified
8 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
9 2643221711 Terrabacter sp. Root85 Isolate Unclassified
10 2738541305 Nocardioides sp. CF167 Isolate Unclassified
11 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
12 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
13 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
14 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
15 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
16 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
17 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
18 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
19 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
20 2904504865 Serratia marcescens 1822 Isolate Unclassified
21 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
70 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
71 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
72 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
79 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
82 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
83 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
84 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
97 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.67
Metatranscriptomes 0
Isolates 15.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.92
Nodule 1.46
Rhizoplane 21.9
Rhizosphere 58.39
Stem 0
Stem Tuber 0
Unclassified 15.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009744 3300001979 Bacteria 3741
2 JGI24737J22298_10013272 3300001990 Bacteria 2683
3 Ga0070682_100148889 3300005337 Bacteria 1604
4 Ga0070661_100165286 3300005344 Bacteria 1678
5 Ga0070714_100000077 3300005435 Bacteria 84205
6 Ga0070663_100184376 3300005455 Bacteria 1621
7 Ga0070679_100187625 3300005530 Bacteria 2037
8 Ga0068853_100042175 3300005539 Bacteria 3900
9 Ga0070672_100191391 3300005543 Bacteria 1708
10 Ga0070665_100075651 3300005548 Bacteria 3374
11 Ga0068857_100046234 3300005577 Bacteria 3863
12 Ga0068859_100282338 3300005617 Bacteria 1753
13 Ga0081455_10097492 3300005937 Bacteria 2369
14 Ga0075365_10001372 3300006038 Bacteria 10946
15 Ga0075364_10092405 3300006051 Bacteria 2009
16 Ga0097620_100282318 3300006931 Bacteria 1753
17 Ga0079104_1000010 3300006946 Bacteria 366021
18 Ga0105250_10000002 3300009092 Bacteria 566949
19 Ga0157372_10054146 3300013307 Bacteria 4474
20 Ga0157375_10131776 3300013308 Bacteria 2620
21 Ga0157375_10436236 3300013308 Bacteria 1476
22 Ga0157380_10016673 3300014326 Bacteria 5423
23 Ga0163161_10009645 3300017792 Bacteria 6679
24 Ga0213872_10001981 3300021361 Bacteria 12469
25 Ga0207696_1000021 3300025711 Bacteria 432606
26 Ga0207688_10129401 3300025901 Bacteria 1479
27 Ga0207647_10050955 3300025904 Bacteria 2561
28 Ga0207650_10131310 3300025925 Bacteria 1960
29 Ga0207664_10000091 3300025929 Bacteria 84244
30 Ga0207674_10011719 3300026116 Bacteria 9841
31 Ga0207698_10261965 3300026142 Bacteria 1589
32 Ga0209281_1000053 3300027111 Bacteria 309587
33 Ga0268265_10090288 3300028380 Bacteria 2447
34 Ga0307513_10129523 3300031456 Bacteria 2472
35 Ga0307405_10089504 3300031731 Bacteria 2034
36 Ga0307409_100011140 3300031995 Bacteria 5647
37 Ga0395900_0066514 3300037418 Bacteria 3703
38 Ga0395900_0095464 3300037418 Bacteria 3055
39 Ga0395898_0096250 3300037466 Bacteria 2844
40 Ga0395898_0111786 3300037466 Bacteria 2618
41 Ga0395905_0085168 3300037471 Bacteria 2962
42 Ga0436364_1193326 3300037853 Bacteria 6592
43 Ga0395901_0065727 3300038443 Bacteria 3777
44 Ga0395901_0089980 3300038443 Bacteria 3212
45 Ga0395901_0106282 3300038443 Bacteria 2946
46 Ga0395901_0113172 3300038443 Bacteria 2850
47 Ga0466972_0007524 3300044658 Bacteria 5465
48 Ga0466965_0001284 3300044683 Bacteria 10001
49 Ga0466965_0049407 3300044683 Bacteria 2085
50 Ga0466961_0050424 3300044693 Bacteria 2658
51 Ga0466970_0003385 3300044765 Bacteria 7764
52 Ga0466970_0057874 3300044765 Bacteria 2073
53 Ga0466970_0060369 3300044765 Bacteria 2030
54 Ga0466957_0025098 3300044842 Bacteria 3531
55 Ga0466960_0017879 3300044901 Bacteria 3100
56 Ga0466960_0019385 3300044901 Bacteria 2997
57 Ga0466960_0105710 3300044901 Bacteria 1455
58 Ga0466967_0075173 3300045976 Bacteria 3036
59 Ga0466967_0109828 3300045976 Bacteria 2532
60 Ga0466967_0158629 3300045976 Bacteria 2122
61 Ga0495635_0091933 3300046663 Bacteria 2075
62 Ga0495602_0245793 3300048088 Bacteria 1336
63 Ga0496100_0066215 3300048903 Bacteria 2396
64 Ga0496100_0066231 3300048903 Bacteria 2395
65 Ga0496101_0005616 3300048904 Bacteria 7997
66 Ga0496101_0112502 3300048904 Bacteria 2051
67 Ga0496101_0127849 3300048904 Bacteria 1927
68 Ga0496101_0156803 3300048904 Bacteria 1744
69 Ga0496101_0368842 3300048904 Bacteria 1129
70 Ga0496102_0000072 3300048905 Bacteria 150284
71 Ga0496102_0055094 3300048905 Bacteria 3626
72 Ga0496102_0068854 3300048905 Bacteria 3248
73 Ga0496102_0219391 3300048905 Bacteria 1792
74 Ga0496103_0000053 3300048906 Bacteria 148944
75 Ga0496103_0006350 3300048906 Bacteria 7064
76 Ga0496104_0031599 3300048907 Bacteria 4924
77 Ga0496104_0041590 3300048907 Bacteria 4311
78 Ga0496105_0019768 3300048908 Bacteria 5434
79 Ga0496105_0065959 3300048908 Bacteria 2987
80 Ga0496105_0093465 3300048908 Bacteria 2483
81 Ga0496106_0152757 3300048909 Bacteria 1822
82 Ga0496108_0145945 3300048911 Bacteria 2040
83 Ga0496108_0151281 3300048911 Bacteria 2003
84 Ga0496108_0282419 3300048911 Bacteria 1445
85 Ga0496108_0352183 3300048911 Bacteria 1285
86 Ga0496109_0189971 3300048912 Bacteria 1930
87 Ga0496114_0033378 3300048917 Bacteria 4240
88 Ga0496114_0042789 3300048917 Bacteria 3754
89 Ga0496114_0052901 3300048917 Bacteria 3384
90 Ga0496114_0108640 3300048917 Bacteria 2375
91 Ga0496114_0118137 3300048917 Bacteria 2278
92 Ga0496114_0133358 3300048917 Bacteria 2147
93 Ga0496116_0004536 3300048919 Bacteria 13199
94 Ga0496118_0024355 3300048921 Bacteria 5226
95 Ga0496121_0003369 3300048924 Bacteria 22908
96 Ga0496124_0006867 3300048927 Bacteria 12256
97 Ga0501033_0195240 3300049570 Bacteria 1447
98 Ga0501034_0116145 3300049571 Bacteria 2664
99 Ga0501036_0109816 3300049572 Bacteria 2330
100 Ga0501038_0017463 3300049574 Bacteria 6486
101 Ga0501041_0119167 3300049577 Bacteria 1639
102 Ga0501042_0024378 3300049578 Bacteria 4243
103 Ga0501046_0030997 3300049580 Bacteria 4338
104 Ga0501048_0037348 3300049582 Bacteria 3488
105 Ga0501068_0059308 3300049584 Bacteria 2324
106 Ga0501072_0015469 3300049588 Bacteria 5849
107 Ga0501076_0111909 3300049592 Bacteria 2207
108 Ga0501077_0140394 3300049593 Bacteria 1532
109 Ga0501079_0069499 3300049741 Bacteria 2718
110 Ga0501080_0102255 3300049742 Bacteria 2658
111 Ga0501083_0102893 3300049744 Bacteria 1883
112 Ga0501044_0061402 3300049823 Bacteria 3845
113 nmdc:mga0yw44_8151_c1 3300050492 Bacteria 2501
114 Ga0500573_0005526 3300053140 Bacteria 6782
115 Ga0501082_0035716 3300060353 Bacteria 4283
116 Ga0530510_0007177 3300061734 Bacteria 7755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0004536 Ga0496116_0004536_10752_11951 298
2 3300005937 Ga0081455_10097492 Ga0081455_100974923 303
3 3300045976 Ga0466967_0075173 Ga0466967_0075173_894_2168 306
4 3300048904 Ga0496101_0112502 Ga0496101_0112502_17_1168 331
5 iso_pu_bacteria 2643221567 2643853342 331
6 3300009092 Ga0105250_10000002 Ga0105250_10000002462 334
7 3300025711 Ga0207696_1000021 Ga0207696_100002145 334
8 3300048904 Ga0496101_0368842 Ga0496101_0368842_11_1105 334
9 3300049593 Ga0501077_0140394 Ga0501077_0140394_262_1413 335
10 3300006946 Ga0079104_1000010 Ga0079104_100001046 341
11 3300027111 Ga0209281_1000053 Ga0209281_100005371 341
12 3300005548 Ga0070665_100075651 Ga0070665_1000756513 342
13 3300045976 Ga0466967_0158629 Ga0466967_0158629_398_1642 342
14 3300048924 Ga0496121_0003369 Ga0496121_0003369_17098_18300 342
15 3300048927 Ga0496124_0006867 Ga0496124_0006867_8354_9556 342
16 3300048905 Ga0496102_0068854 Ga0496102_0068854_588_1814 344
17 3300048903 Ga0496100_0066231 Ga0496100_0066231_253_1545 345
18 3300048904 Ga0496101_0005616 Ga0496101_0005616_4618_5910 345
19 3300048905 Ga0496102_0055094 Ga0496102_0055094_1546_2838 345
20 3300048906 Ga0496103_0006350 Ga0496103_0006350_5477_6769 345
21 3300048907 Ga0496104_0031599 Ga0496104_0031599_2810_4102 345
22 3300048908 Ga0496105_0065959 Ga0496105_0065959_660_1952 345
23 3300048909 Ga0496106_0152757 Ga0496106_0152757_251_1489 345
24 3300048911 Ga0496108_0282419 Ga0496108_0282419_62_1288 345
25 3300048917 Ga0496114_0033378 Ga0496114_0033378_1913_3205 345
26 3300048908 Ga0496105_0093465 Ga0496105_0093465_1020_2258 346
27 3300049571 Ga0501034_0116145 Ga0501034_0116145_222_1478 347
28 iso_pu_bacteria 2510917022 2511131487 347
29 3300045976 Ga0466967_0109828 Ga0466967_0109828_1074_2336 348
30 iso_pu_bacteria 2643221576 2643890082 349
31 iso_pu_bacteria 2643221590 2643959138 349
32 3300037853 Ga0436364_1193326 Ga0436364_1193326_835_2094 350
33 3300048917 Ga0496114_0108640 Ga0496114_0108640_63_1205 350
34 3300037466 Ga0395898_0096250 Ga0395898_0096250_1420_2679 351
35 iso_pu_bacteria 2904504865 2904507768 351
36 3300013308 Ga0157375_10131776 Ga0157375_101317762 352
37 3300025901 Ga0207688_10129401 Ga0207688_101294012 352
38 3300048904 Ga0496101_0127849 Ga0496101_0127849_634_1860 352
39 3300037471 Ga0395905_0085168 Ga0395905_0085168_1770_2924 353
40 3300038443 Ga0395901_0089980 Ga0395901_0089980_1757_2995 353
41 3300028380 Ga0268265_10090288 Ga0268265_100902882 354
42 3300005530 Ga0070679_100187625 Ga0070679_1001876252 356
43 3300017792 Ga0163161_10009645 Ga0163161_100096452 356
44 3300005455 Ga0070663_100184376 Ga0070663_1001843762 357
45 3300046663 Ga0495635_0091933 Ga0495635_0091933_665_1897 357
46 3300048088 Ga0495602_0245793 Ga0495602_0245793_99_1322 357
47 3300048917 Ga0496114_0118137 Ga0496114_0118137_173_1414 357
48 iso_pu_bacteria 2643221604 2644033620 358
49 3300048904 Ga0496101_0156803 Ga0496101_0156803_115_1377 359
50 3300048905 Ga0496102_0219391 Ga0496102_0219391_197_1459 359
51 3300048917 Ga0496114_0042789 Ga0496114_0042789_705_1967 359
52 3300005344 Ga0070661_100165286 Ga0070661_1001652862 360
53 3300005577 Ga0068857_100046234 Ga0068857_1000462342 360
54 3300026116 Ga0207674_10011719 Ga0207674_100117194 360
55 3300044901 Ga0466960_0019385 Ga0466960_0019385_114_1346 360
56 3300048912 Ga0496109_0189971 Ga0496109_0189971_612_1850 360
57 iso_pu_bacteria 2811994882 2812374302 360
58 iso_pu_bacteria 2818991318 2819427015 360
59 iso_pu_bacteria 2818991458 2819666007 360
60 iso_pu_bacteria 2818991462 2819692502 360
61 iso_pu_bacteria 2818991469 2819728744 360
62 3300026142 Ga0207698_10261965 Ga0207698_102619651 361
63 3300037466 Ga0395898_0111786 Ga0395898_0111786_1072_2289 361
64 3300044693 Ga0466961_0050424 Ga0466961_0050424_1358_2560 361
65 3300044765 Ga0466970_0003385 Ga0466970_0003385_706_1908 361
66 3300044842 Ga0466957_0025098 Ga0466957_0025098_270_1472 361
67 3300044901 Ga0466960_0017879 Ga0466960_0017879_1204_2406 361
68 3300048911 Ga0496108_0151281 Ga0496108_0151281_236_1447 361
69 iso_pu_bacteria 2808606365 2808874766 361
70 3300005435 Ga0070714_100000077 Ga0070714_10000007771 362
71 3300013308 Ga0157375_10436236 Ga0157375_104362361 362
72 3300025929 Ga0207664_10000091 Ga0207664_1000009112 362
73 3300044683 Ga0466965_0001284 Ga0466965_0001284_5049_6263 362
74 3300048911 Ga0496108_0352183 Ga0496108_0352183_35_1264 362
75 3300021361 Ga0213872_10001981 Ga0213872_1000198113 363
76 3300037418 Ga0395900_0066514 Ga0395900_0066514_1138_2400 363
77 3300038443 Ga0395901_0113172 Ga0395901_0113172_796_2046 363
78 3300048905 Ga0496102_0000072 Ga0496102_0000072_119284_120507 363
79 3300048906 Ga0496103_0000053 Ga0496103_0000053_92311_93534 363
80 3300048911 Ga0496108_0145945 Ga0496108_0145945_110_1321 363
81 3300048921 Ga0496118_0024355 Ga0496118_0024355_756_1979 363
82 3300049823 Ga0501044_0061402 Ga0501044_0061402_1389_2591 363
83 3300053140 Ga0500573_0005526 Ga0500573_0005526_3670_4887 363
84 iso_pu_bacteria 2816332119 2816421318 363
85 3300005337 Ga0070682_100148889 Ga0070682_1001488892 364
86 3300006038 Ga0075365_10001372 Ga0075365_100013722 364
87 3300014326 Ga0157380_10016673 Ga0157380_100166735 364
88 3300031995 Ga0307409_100011140 Ga0307409_1000111402 364
89 3300044765 Ga0466970_0060369 Ga0466970_0060369_18_1229 364
90 3300048903 Ga0496100_0066215 Ga0496100_0066215_857_2095 364
91 3300048907 Ga0496104_0041590 Ga0496104_0041590_1743_2957 364
92 3300048908 Ga0496105_0019768 Ga0496105_0019768_3829_5043 364
93 3300048917 Ga0496114_0133358 Ga0496114_0133358_451_1665 364
94 3300050492 nmdc:mga0yw44_8151_c1 nmdc:mga0yw44_8151_c1_538_1758 364
95 iso_pu_bacteria 2643221711 2644609164 364
96 iso_pu_bacteria 2919446982 2919447063 365
97 3300005617 Ga0068859_100282338 Ga0068859_1002823382 366
98 3300006051 Ga0075364_10092405 Ga0075364_100924052 366
99 3300006931 Ga0097620_100282318 Ga0097620_1002823182 366
100 3300031731 Ga0307405_10089504 Ga0307405_100895042 366
101 3300037418 Ga0395900_0095464 Ga0395900_0095464_557_1786 366
102 3300038443 Ga0395901_0065727 Ga0395901_0065727_1150_2367 366
103 3300038443 Ga0395901_0106282 Ga0395901_0106282_1283_2512 366
104 3300044658 Ga0466972_0007524 Ga0466972_0007524_133_1380 366
105 3300044683 Ga0466965_0049407 Ga0466965_0049407_696_1922 366
106 3300044765 Ga0466970_0057874 Ga0466970_0057874_606_1832 366
107 3300044901 Ga0466960_0105710 Ga0466960_0105710_142_1368 366
108 3300048917 Ga0496114_0052901 Ga0496114_0052901_450_1682 366
109 3300049570 Ga0501033_0195240 Ga0501033_0195240_74_1342 366
110 3300049572 Ga0501036_0109816 Ga0501036_0109816_14_1345 366
111 3300049574 Ga0501038_0017463 Ga0501038_0017463_179_1510 366
112 3300049577 Ga0501041_0119167 Ga0501041_0119167_94_1425 366
113 3300049578 Ga0501042_0024378 Ga0501042_0024378_2876_4207 366
114 3300049580 Ga0501046_0030997 Ga0501046_0030997_1199_2428 366
115 3300049582 Ga0501048_0037348 Ga0501048_0037348_204_1535 366
116 3300049584 Ga0501068_0059308 Ga0501068_0059308_805_2136 366
117 3300049588 Ga0501072_0015469 Ga0501072_0015469_404_1735 366
118 3300049592 Ga0501076_0111909 Ga0501076_0111909_56_1387 366
119 3300049741 Ga0501079_0069499 Ga0501079_0069499_496_1827 366
120 3300049742 Ga0501080_0102255 Ga0501080_0102255_653_1984 366
121 3300049744 Ga0501083_0102893 Ga0501083_0102893_197_1528 366
122 3300060353 Ga0501082_0035716 Ga0501082_0035716_2103_3434 366
123 3300061734 Ga0530510_0007177 Ga0530510_0007177_137_1468 366
124 iso_pu_bacteria 2643221617 2644102937 366
125 iso_pu_bacteria 2643221620 2644118595 366
126 iso_pu_bacteria 2643221624 2644137302 366
127 iso_pu_bacteria 2738541305 2738872031 366
128 iso_pu_bacteria 2811994874 2812334317 366
129 iso_pu_bacteria 2857481737 2857485209 366
130 3300001979 JGI24740J21852_10009744 JGI24740J21852_100097441 367
131 3300001990 JGI24737J22298_10013272 JGI24737J22298_100132722 367
132 3300005539 Ga0068853_100042175 Ga0068853_1000421755 367
133 3300005543 Ga0070672_100191391 Ga0070672_1001913912 367
134 3300013307 Ga0157372_10054146 Ga0157372_100541462 367
135 3300025904 Ga0207647_10050955 Ga0207647_100509552 367
136 3300025925 Ga0207650_10131310 Ga0207650_101313102 367
137 3300031456 Ga0307513_10129523 Ga0307513_101295232 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

46

358

0.86

PF06779

MFS_4

Uncharacterised MFS-type transporter YbfB

50

410

0.83

PF07690

MFS_1

Major Facilitator Superfamily

252

441

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8271 11 360
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.807 13 360
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8069 13 352
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8031 9 360
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.7919 11 360
ID Description Score Start End Superfamily
af_P77589_11_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9228 10 182 1.20.1250.20
af_P9WJX7_21_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9144 14 185 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8933 15 184 1.20.1250.20
af_P23910_1_374_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8875 12 357 1.20.1250.20
af_Q2G2W1_141_346_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.881 15 176 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A520BAV2-F1-model_v4 MFS transporter 0.9448 13 205 GO:0005886
GO:0022857
AF-A0A0A3ZLA7-F1-model_v4 deleted 0.9396 2 184
AF-A0A7C1W5G5-F1-model_v4 MFS transporter 0.939 11 231 GO:0005886
GO:0022857
AF-A0A085AM53-F1-model_v4 Major facilitator superfamily (MFS) transporter 0.9339 12 184 GO:0005886
GO:0022857
AF-A0A378A2X1-F1-model_v4 MFS transporter 0.9264 12 240 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
83 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map