F170156

General Info

Members Datasets Scaffolds Average Seq Length
137 51 136 262

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10070274|Ga0265334_100702742
Length 295
Sequence MTVSSLISDAIVVPSKEDDNVLHFIPKEKGNDIFDPTAKSRPMVDQSHISVRNLNVYLQKNHILKNVNLDIPNKAITCIMGPSGCGKTTLLKTFNRLLEQSSNVKISGEVLVDGENIHDKNVETMHIRKKMGLLSQRPCPLPMSIYDNIAYGPKIHGIRNKKKLRQIVEYYLKVAELWDEVKDRLSSPAISLSIGQQQRLCLARGLAVEPEIILGDEATSALDPISSKKIEELFVRLKKQYSIVLVTHTLRQVKRIADYVIFMYLGEVIEAGTSTEIFKNPKETLTKEYISGYFS

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
4 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
8 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
9 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
10 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
11 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
13 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
14 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
15 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
16 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
24 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
25 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
26 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
27 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
28 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
29 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
30 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
31 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
32 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
33 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
34 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
35 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
36 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
37 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
38 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
39 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
40 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
41 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
42 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
43 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
44 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
45 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
46 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
47 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
48 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
49 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
50 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
51 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.73
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10136598 3300003323 Bacteria 11763
2 Ga0070714_100050481 3300005435 Bacteria 3544
3 Ga0070708_100780980 3300005445 Bacteria 898
4 Ga0070707_100021191 3300005468 Bacteria 6142
5 Ga0068853_100000334 3300005539 Bacteria 32923
6 Ga0068855_100000045 3300005563 Bacteria 147511
7 Ga0068859_100014405 3300005617 Bacteria 7934
8 Ga0075428_100088064 3300006844 Bacteria 3387
9 Ga0097620_100014404 3300006931 Bacteria 7934
10 Ga0105240_10161069 3300009093 Bacteria 2665
11 Ga0114129_10034178 3300009147 Bacteria 7179
12 Ga0114129_10319157 3300009147 Bacteria 2065
13 Ga0105238_10001114 3300009551 Bacteria 27121
14 Ga0157370_10045852 3300013104 Bacteria 4193
15 Ga0213873_10007649 3300021358 Bacteria 2173
16 Ga0213872_10003272 3300021361 Bacteria 9040
17 Ga0213872_10022264 3300021361 Bacteria 2919
18 Ga0207695_10421660 3300025913 Bacteria 1218
19 Ga0207646_10020366 3300025922 Bacteria 6148
20 Ga0207646_10202749 3300025922 Bacteria 1792
21 Ga0207694_10004688 3300025924 Bacteria 10641
22 Ga0207667_10000295 3300025949 Bacteria 68803
23 Ga0207667_10051983 3300025949 Bacteria 4317
24 Ga0207639_10001313 3300026041 Bacteria 16816
25 Ga0207676_10143720 3300026095 Bacteria 2046
26 Ga0207698_10137616 3300026142 Bacteria 2098
27 Ga0265334_10070274 3300028573 Bacteria 1305
28 Ga0265323_10005757 3300028653 Bacteria 5247
29 Ga0265338_10070784 3300028800 Bacteria 2988
30 Ga0265338_10086305 3300028800 Bacteria 2613
31 Ga0265338_10160776 3300028800 Bacteria 1735
32 Ga0265327_10003171 3300031251 Bacteria 16103
33 Ga0265327_10007809 3300031251 Bacteria 8148
34 Ga0307508_10004339 3300031616 Bacteria 13876
35 Ga0316579_10149585 3300031691 Unclassified 1126
36 Ga0265342_10054044 3300031712 Bacteria 2388
37 Ga0316578_10202652 3300031728 Bacteria 1194
38 Ga0316577_10072747 3300031733 Bacteria 1919
39 Ga0373934_0055650 3300035086 Bacteria 1572
40 Ga0373956_0142208 3300035119 Unclassified 1127
41 Ga0373955_0166540 3300035172 Bacteria 1303
42 Ga0373955_0283766 3300035172 Bacteria 996
43 Ga0373933_0000211 3300035724 Bacteria 38691
44 Ga0373933_0086243 3300035724 Bacteria 1932
45 Ga0373933_0282121 3300035724 Bacteria 1073
46 Ga0373937_0075476 3300036401 Bacteria 3112
47 Ga0373937_0159904 3300036401 Bacteria 2112
48 Ga0316584_0010324 3300036712 Bacteria 6522
49 Ga0316584_0132522 3300036712 Bacteria 1861
50 Ga0316584_0136287 3300036712 Bacteria 1832
51 Ga0436361_0476450 3300039447 Bacteria 2278
52 Ga0436362_1221139 3300039453 Bacteria 8778
53 Ga0451795_0513509 3300041456 Bacteria 6444
54 Ga0451855_0243570 3300041511 Bacteria 1040
55 Ga0451577_0000072 3300042876 Bacteria 237934
56 Ga0451577_0007760 3300042876 Bacteria 10518
57 Ga0451577_0007858 3300042876 Bacteria 10431
58 Ga0451577_0009613 3300042876 Bacteria 9280
59 Ga0451577_0016294 3300042876 Bacteria 6886
60 Ga0451577_0018753 3300042876 Bacteria 6366
61 Ga0451577_0021205 3300042876 Bacteria 5949
62 Ga0451577_0074802 3300042876 Bacteria 3020
63 Ga0451577_0111114 3300042876 Bacteria 2452
64 Ga0451577_0148734 3300042876 Unclassified 2107
65 Ga0451577_0193007 3300042876 Bacteria 1837
66 Ga0451577_0214509 3300042876 Bacteria 1739
67 Ga0451577_0320645 3300042876 Bacteria 1405
68 Ga0451577_0432190 3300042876 Bacteria 1195
69 Ga0451577_0434678 3300042876 Bacteria 1192
70 Ga0451577_0465508 3300042876 Bacteria 1148
71 Ga0451577_0632769 3300042876 Bacteria 970
72 Ga0466969_0005591 3300044656 Bacteria 6680
73 Ga0453683_0000139 3300044673 Bacteria 105329
74 Ga0453683_0000178 3300044673 Bacteria 88310
75 Ga0453683_0003535 3300044673 Bacteria 11487
76 Ga0453683_0010455 3300044673 Bacteria 6149
77 Ga0453683_0012736 3300044673 Bacteria 5505
78 Ga0453683_0026378 3300044673 Bacteria 3690
79 Ga0453683_0057081 3300044673 Bacteria 2443
80 Ga0453683_0077614 3300044673 Unclassified 2080
81 Ga0453683_0089899 3300044673 Bacteria 1925
82 Ga0453683_0124303 3300044673 Bacteria 1624
83 Ga0453683_0156992 3300044673 Unclassified 1438
84 Ga0453683_0173842 3300044673 Bacteria 1364
85 Ga0453683_0356313 3300044673 Bacteria 940
86 Ga0453684_0000012 3300044712 Bacteria 1062512
87 Ga0453684_0000186 3300044712 Bacteria 273302
88 Ga0453684_0000448 3300044712 Bacteria 166223
89 Ga0453684_0000640 3300044712 Bacteria 126342
90 Ga0453684_0000706 3300044712 Bacteria 118423
91 Ga0453684_0000899 3300044712 Bacteria 99196
92 Ga0453684_0000944 3300044712 Bacteria 95859
93 Ga0453684_0002911 3300044712 Bacteria 40123
94 Ga0453684_0003121 3300044712 Bacteria 38162
95 Ga0453684_0003340 3300044712 Bacteria 36413
96 Ga0453684_0004230 3300044712 Bacteria 30749
97 Ga0453684_0005222 3300044712 Bacteria 26023
98 Ga0453684_0007654 3300044712 Bacteria 19769
99 Ga0453684_0008018 3300044712 Bacteria 19114
100 Ga0453684_0008655 3300044712 Bacteria 18116
101 Ga0453684_0009259 3300044712 Bacteria 17295
102 Ga0453684_0016939 3300044712 Bacteria 11332
103 Ga0453684_0017169 3300044712 Bacteria 11242
104 Ga0453684_0022950 3300044712 Bacteria 9227
105 Ga0453684_0057611 3300044712 Bacteria 5027
106 Ga0453684_0076075 3300044712 Bacteria 4216
107 Ga0453684_0076171 3300044712 Unclassified 4212
108 Ga0453684_0100289 3300044712 Unclassified 3544
109 Ga0453684_0125955 3300044712 Unclassified 3083
110 Ga0453684_0147543 3300044712 Bacteria 2800
111 Ga0453684_0165199 3300044712 Unclassified 2614
112 Ga0453684_0174572 3300044712 Bacteria 2529
113 Ga0453684_0255548 3300044712 Bacteria 2010
114 Ga0453684_0283411 3300044712 Bacteria 1889
115 Ga0453684_0283787 3300044712 Unclassified 1887
116 Ga0453684_0300231 3300044712 Bacteria 1825
117 Ga0453684_0500494 3300044712 Bacteria 1345
118 Ga0453684_0552900 3300044712 Bacteria 1268
119 Ga0453684_0866252 3300044712 Bacteria 970
120 Ga0453684_1134048 3300044712 Bacteria 824
121 Ga0466959_0042461 3300045049 Bacteria 3354
122 Ga0451576_0000065 3300045051 Bacteria 274445
123 Ga0451576_0000187 3300045051 Bacteria 155783
124 Ga0451576_0000549 3300045051 Bacteria 80496
125 Ga0451576_0001483 3300045051 Bacteria 39693
126 Ga0451576_0009064 3300045051 Bacteria 11586
127 Ga0451576_0012481 3300045051 Bacteria 9540
128 Ga0451576_0015275 3300045051 Bacteria 8512
129 Ga0451576_0037521 3300045051 Bacteria 5132
130 Ga0451576_0057886 3300045051 Bacteria 4051
131 Ga0451576_0117521 3300045051 Bacteria 2768
132 Ga0451576_0173487 3300045051 Bacteria 2251
133 Ga0501073_0031731 3300049589 Bacteria 3769
134 nmdc:mga05p37_277118_c1 3300050507 Bacteria 2002
135 nmdc:mga05p37_38118_c1 3300050507 Bacteria 5895
136 Ga0501084_0046378 3300054114 Bacteria 3640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0632769 Ga0451577_0632769_297_947 194
2 3300009147 Ga0114129_10319157 Ga0114129_103191573 229
3 3300031251 Ga0265327_10007809 Ga0265327_100078093 229
4 3300031691 Ga0316579_10149585 Ga0316579_101495852 229
5 3300036712 Ga0316584_0136287 Ga0316584_0136287_1042_1794 229
6 3300042876 Ga0451577_0007858 Ga0451577_0007858_8666_9421 229
7 3300042876 Ga0451577_0009613 Ga0451577_0009613_2005_2760 229
8 3300042876 Ga0451577_0074802 Ga0451577_0074802_2024_2779 229
9 3300044673 Ga0453683_0003535 Ga0453683_0003535_1397_2152 229
10 3300044673 Ga0453683_0010455 Ga0453683_0010455_4472_5227 229
11 3300044673 Ga0453683_0012736 Ga0453683_0012736_2875_3630 229
12 3300044673 Ga0453683_0057081 Ga0453683_0057081_1556_2311 229
13 3300044673 Ga0453683_0156992 Ga0453683_0156992_419_1174 229
14 3300044712 Ga0453684_0000012 Ga0453684_0000012_206110_206865 229
15 3300044712 Ga0453684_0000899 Ga0453684_0000899_86773_87528 229
16 3300044712 Ga0453684_0000944 Ga0453684_0000944_14270_15025 229
17 3300044712 Ga0453684_0005222 Ga0453684_0005222_10526_11281 229
18 3300044712 Ga0453684_0008018 Ga0453684_0008018_17602_18357 229
19 3300044712 Ga0453684_0009259 Ga0453684_0009259_8512_9267 229
20 3300044712 Ga0453684_0016939 Ga0453684_0016939_329_1084 229
21 3300044712 Ga0453684_0057611 Ga0453684_0057611_851_1606 229
22 3300044712 Ga0453684_0076075 Ga0453684_0076075_3367_4122 229
23 3300044712 Ga0453684_0076171 Ga0453684_0076171_661_1416 229
24 3300044712 Ga0453684_0100289 Ga0453684_0100289_1352_2107 229
25 3300044712 Ga0453684_0174572 Ga0453684_0174572_615_1370 229
26 3300044712 Ga0453684_0283411 Ga0453684_0283411_610_1365 229
27 3300044712 Ga0453684_0283787 Ga0453684_0283787_40_795 229
28 3300044712 Ga0453684_0300231 Ga0453684_0300231_73_828 229
29 3300044712 Ga0453684_0500494 Ga0453684_0500494_235_990 229
30 3300044712 Ga0453684_0552900 Ga0453684_0552900_13_768 229
31 3300044712 Ga0453684_1134048 Ga0453684_1134048_39_794 229
32 3300045051 Ga0451576_0000187 Ga0451576_0000187_119718_120473 229
33 3300045051 Ga0451576_0001483 Ga0451576_0001483_24305_25060 229
34 3300045051 Ga0451576_0009064 Ga0451576_0009064_4009_4764 229
35 3300045051 Ga0451576_0117521 Ga0451576_0117521_937_1692 229
36 3300049589 Ga0501073_0031731 Ga0501073_0031731_1045_1800 229
37 3300050507 nmdc:mga05p37_38118_c1 nmdc:mga05p37_38118_c1_4955_5719 229
38 3300005435 Ga0070714_100050481 Ga0070714_1000504814 230
39 3300005445 Ga0070708_100780980 Ga0070708_1007809801 230
40 3300042876 Ga0451577_0320645 Ga0451577_0320645_500_1258 230
41 3300042876 Ga0451577_0434678 Ga0451577_0434678_181_939 230
42 3300044673 Ga0453683_0026378 Ga0453683_0026378_2598_3356 230
43 3300044712 Ga0453684_0000640 Ga0453684_0000640_12038_12796 230
44 3300045051 Ga0451576_0173487 Ga0451576_0173487_1434_2192 230
45 3300005563 Ga0068855_100000045 Ga0068855_10000004585 231
46 3300013104 Ga0157370_10045852 Ga0157370_100458522 231
47 3300025949 Ga0207667_10000295 Ga0207667_1000029554 231
48 3300031728 Ga0316578_10202652 Ga0316578_102026522 231
49 3300031733 Ga0316577_10072747 Ga0316577_100727472 231
50 3300035119 Ga0373956_0142208 Ga0373956_0142208_100_858 231
51 3300035724 Ga0373933_0086243 Ga0373933_0086243_923_1681 231
52 3300035724 Ga0373933_0282121 Ga0373933_0282121_51_809 231
53 3300036401 Ga0373937_0159904 Ga0373937_0159904_728_1486 231
54 3300036712 Ga0316584_0010324 Ga0316584_0010324_2214_2972 231
55 3300036712 Ga0316584_0132522 Ga0316584_0132522_20_781 231
56 3300042876 Ga0451577_0018753 Ga0451577_0018753_1081_1893 231
57 3300044712 Ga0453684_0004230 Ga0453684_0004230_17100_17912 231
58 3300054114 Ga0501084_0046378 Ga0501084_0046378_1159_1917 231
59 3300003323 rootH1_10136598 rootH1_1013659813 232
60 3300005468 Ga0070707_100021191 Ga0070707_1000211912 232
61 3300005539 Ga0068853_100000334 Ga0068853_10000033422 232
62 3300005617 Ga0068859_100014405 Ga0068859_1000144057 232
63 3300006844 Ga0075428_100088064 Ga0075428_1000880643 232
64 3300006931 Ga0097620_100014404 Ga0097620_1000144047 232
65 3300009093 Ga0105240_10161069 Ga0105240_101610692 232
66 3300009147 Ga0114129_10034178 Ga0114129_100341786 232
67 3300009551 Ga0105238_10001114 Ga0105238_1000111423 232
68 3300021358 Ga0213873_10007649 Ga0213873_100076492 232
69 3300021361 Ga0213872_10003272 Ga0213872_100032724 232
70 3300021361 Ga0213872_10022264 Ga0213872_100222643 232
71 3300025913 Ga0207695_10421660 Ga0207695_104216602 232
72 3300025922 Ga0207646_10020366 Ga0207646_100203662 232
73 3300025922 Ga0207646_10202749 Ga0207646_102027492 232
74 3300025924 Ga0207694_10004688 Ga0207694_100046883 232
75 3300025949 Ga0207667_10051983 Ga0207667_100519832 232
76 3300026041 Ga0207639_10001313 Ga0207639_100013134 232
77 3300026095 Ga0207676_10143720 Ga0207676_101437202 232
78 3300026142 Ga0207698_10137616 Ga0207698_101376162 232
79 3300028573 Ga0265334_10070274 Ga0265334_100702742 232
80 3300028653 Ga0265323_10005757 Ga0265323_100057574 232
81 3300028800 Ga0265338_10070784 Ga0265338_100707842 232
82 3300028800 Ga0265338_10086305 Ga0265338_100863053 232
83 3300028800 Ga0265338_10160776 Ga0265338_101607762 232
84 3300031251 Ga0265327_10003171 Ga0265327_1000317119 232
85 3300031616 Ga0307508_10004339 Ga0307508_100043393 232
86 3300031712 Ga0265342_10054044 Ga0265342_100540442 232
87 3300035086 Ga0373934_0055650 Ga0373934_0055650_698_1462 232
88 3300035172 Ga0373955_0166540 Ga0373955_0166540_425_1189 232
89 3300035172 Ga0373955_0283766 Ga0373955_0283766_41_835 232
90 3300035724 Ga0373933_0000211 Ga0373933_0000211_31721_32485 232
91 3300036401 Ga0373937_0075476 Ga0373937_0075476_822_1586 232
92 3300039447 Ga0436361_0476450 Ga0436361_0476450_614_1405 232
93 3300039453 Ga0436362_1221139 Ga0436362_1221139_5200_5988 232
94 3300041456 Ga0451795_0513509 Ga0451795_0513509_3491_4252 232
95 3300041511 Ga0451855_0243570 Ga0451855_0243570_113_979 232
96 3300042876 Ga0451577_0000072 Ga0451577_0000072_205281_206153 232
97 3300042876 Ga0451577_0007760 Ga0451577_0007760_4915_5781 232
98 3300042876 Ga0451577_0016294 Ga0451577_0016294_2877_3743 232
99 3300042876 Ga0451577_0021205 Ga0451577_0021205_2327_3199 232
100 3300042876 Ga0451577_0111114 Ga0451577_0111114_345_1178 232
101 3300042876 Ga0451577_0148734 Ga0451577_0148734_275_1144 232
102 3300042876 Ga0451577_0193007 Ga0451577_0193007_703_1569 232
103 3300042876 Ga0451577_0214509 Ga0451577_0214509_258_1016 232
104 3300042876 Ga0451577_0432190 Ga0451577_0432190_328_1167 232
105 3300042876 Ga0451577_0465508 Ga0451577_0465508_19_885 232
106 3300044656 Ga0466969_0005591 Ga0466969_0005591_5584_6342 232
107 3300044673 Ga0453683_0000139 Ga0453683_0000139_46662_47528 232
108 3300044673 Ga0453683_0000178 Ga0453683_0000178_46695_47567 232
109 3300044673 Ga0453683_0077614 Ga0453683_0077614_565_1431 232
110 3300044673 Ga0453683_0089899 Ga0453683_0089899_950_1816 232
111 3300044673 Ga0453683_0124303 Ga0453683_0124303_259_1080 232
112 3300044673 Ga0453683_0173842 Ga0453683_0173842_418_1245 232
113 3300044673 Ga0453683_0356313 Ga0453683_0356313_16_837 232
114 3300044712 Ga0453684_0000186 Ga0453684_0000186_67150_68022 232
115 3300044712 Ga0453684_0000448 Ga0453684_0000448_160468_161334 232
116 3300044712 Ga0453684_0000706 Ga0453684_0000706_64771_65529 232
117 3300044712 Ga0453684_0002911 Ga0453684_0002911_35911_36777 232
118 3300044712 Ga0453684_0003121 Ga0453684_0003121_3079_3945 232
119 3300044712 Ga0453684_0003340 Ga0453684_0003340_22319_23080 232
120 3300044712 Ga0453684_0007654 Ga0453684_0007654_2600_3487 232
121 3300044712 Ga0453684_0008655 Ga0453684_0008655_4257_5108 232
122 3300044712 Ga0453684_0017169 Ga0453684_0017169_7281_8147 232
123 3300044712 Ga0453684_0022950 Ga0453684_0022950_7409_8248 232
124 3300044712 Ga0453684_0125955 Ga0453684_0125955_330_1199 232
125 3300044712 Ga0453684_0147543 Ga0453684_0147543_420_1181 232
126 3300044712 Ga0453684_0165199 Ga0453684_0165199_11_772 232
127 3300044712 Ga0453684_0255548 Ga0453684_0255548_579_1445 232
128 3300044712 Ga0453684_0866252 Ga0453684_0866252_17_883 232
129 3300045049 Ga0466959_0042461 Ga0466959_0042461_908_1666 232
130 3300045051 Ga0451576_0000065 Ga0451576_0000065_68293_69165 232
131 3300045051 Ga0451576_0000549 Ga0451576_0000549_4890_5756 232
132 3300045051 Ga0451576_0012481 Ga0451576_0012481_103_936 232
133 3300045051 Ga0451576_0015275 Ga0451576_0015275_492_1358 232
134 3300045051 Ga0451576_0037521 Ga0451576_0037521_3754_4515 232
135 3300045051 Ga0451576_0057886 Ga0451576_0057886_1119_1988 232
136 3300050507 nmdc:mga05p37_277118_c1 nmdc:mga05p37_277118_c1_587_1357 232
137 iso_pu_bacteria 8054280661 8054281193 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

64

220

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9089 4 215
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9024 4 215
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9014 5 230
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.8988 7 228
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.897 4 231
ID Description Score Start End Superfamily
af_Q2FYQ0_38_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9381 10 227 3.40.50.300
af_P9WQK9_23_275_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9331 10 230 3.40.50.300
af_P77622_3_308_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9042 4 229 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9011 3 229 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9007 1 214 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A349ULC9-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9448 1 232 GO:0005524
GO:0015415
GO:0016020
GO:0016887
GO:0035435
AF-A0A374DCB4-F1-model_v4 deleted 0.9417 2 232
AF-A0A349ULC9-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9408 1 232 GO:0005524
GO:0015415
GO:0016020
GO:0016887
GO:0035435
AF-Q5QVB0-F1-model_v4 Phosphate import ATP-binding protein PstB (EC 7.3.2.1) (ABC phosphate transporter) (Phosphate-transporting ATPase) 0.9397 5 232 GO:0005524
GO:0005886
GO:0015415
GO:0016887
GO:0035435
AF-A0A7U9C389-F1-model_v4 Phosphate import ATP-binding protein pstB 2 0.9393 5 232 GO:0005315
GO:0005524
GO:0016020
GO:0016887
GO:0035435

Feature Viewer

pLDDT pTM Quality
92.29 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map