F169651

General Info

Members Datasets Scaffolds Average Seq Length
137 100 137 212

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10003907|Ga0114129_100039073
Length 246
Sequence VNSFLAEIEPPWALTGVGANQLIGVLFVLGLAWGFVADRIGARWPAHEDGSRRPLGWRTVVTMALGGLALALLAVPAGGTTFDATATLRFRPAATAFIGLYVLALIVLLATDLDQRLLPDVLTLPMIPYALIGAWLGISPYVSFQSGFVLDLAAAIGLPLGLFLLSIPFGRGAIGIGDLKLLVSVGFLAGAERAVIGLIFGAILSAVVILVLLVGRRITLKSYIPYGPFLIIGVLWALLGPLGGRG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
57 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
79 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
85 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.38
Rhizosphere 92.7
Stem 0
Stem Tuber 0
Unclassified 2.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10003198 3300003320 Bacteria 2956
2 rootL2_10017933 3300003322 Bacteria 3468
3 rootH1_10291617 3300003323 Bacteria 2595
4 Ga0068869_100154298 3300005334 Bacteria 1783
5 Ga0070680_100000002 3300005336 Bacteria 211003
6 Ga0070680_100750856 3300005336 Unclassified 840
7 Ga0070692_10028127 3300005345 Bacteria 2793
8 Ga0070674_100018453 3300005356 Bacteria 4411
9 Ga0070674_100149736 3300005356 Bacteria 1760
10 Ga0070701_10122507 3300005438 Unclassified 1467
11 Ga0070705_100018721 3300005440 Bacteria 3634
12 Ga0070705_100123347 3300005440 Bacteria 1677
13 Ga0070694_100388672 3300005444 Bacteria 1090
14 Ga0070708_100005137 3300005445 Bacteria 10363
15 Ga0070708_100022411 3300005445 Bacteria 5358
16 Ga0070662_100089027 3300005457 Bacteria 2315
17 Ga0070681_10738015 3300005458 Bacteria 901
18 Ga0070706_100027597 3300005467 Bacteria 5224
19 Ga0070706_100064786 3300005467 Bacteria 3378
20 Ga0070706_100135863 3300005467 Bacteria 2295
21 Ga0070706_100206846 3300005467 Bacteria 1833
22 Ga0070707_100008051 3300005468 Bacteria 9786
23 Ga0070707_100068087 3300005468 Bacteria 3425
24 Ga0070698_100037986 3300005471 Bacteria 4963
25 Ga0070699_100028950 3300005518 Bacteria 4775
26 Ga0070699_100094484 3300005518 Bacteria 2617
27 Ga0070699_100634307 3300005518 Bacteria 975
28 Ga0070679_100790731 3300005530 Unclassified 892
29 Ga0070697_100018299 3300005536 Bacteria 5523
30 Ga0070697_100163365 3300005536 Unclassified 1882
31 Ga0070696_100027757 3300005546 Bacteria 3860
32 Ga0070696_100251152 3300005546 Unclassified 1337
33 Ga0070696_100537829 3300005546 Bacteria 934
34 Ga0070693_100382494 3300005547 Unclassified 971
35 Ga0070702_100255168 3300005615 Bacteria 1191
36 Ga0070702_100401503 3300005615 Unclassified 981
37 Ga0068859_100426179 3300005617 Unclassified 1423
38 Ga0068860_100763843 3300005843 Bacteria 979
39 Ga0070712_100378288 3300006175 Bacteria 1165
40 Ga0075428_100012778 3300006844 Bacteria 9336
41 Ga0075433_10061027 3300006852 Bacteria 3302
42 Ga0068865_100070915 3300006881 Bacteria 2470
43 Ga0068865_100178659 3300006881 Bacteria 1633
44 Ga0075436_100222089 3300006914 Bacteria 1341
45 Ga0097620_100426226 3300006931 Unclassified 1423
46 Ga0105245_10028712 3300009098 Bacteria 4909
47 Ga0114129_10003907 3300009147 Bacteria 21036
48 Ga0105243_10192861 3300009148 Bacteria 1781
49 Ga0105243_10196727 3300009148 Bacteria 1765
50 Ga0105242_10090387 3300009176 Bacteria 2576
51 Ga0105242_10096938 3300009176 Bacteria 2492
52 Ga0105248_10662735 3300009177 Bacteria 1177
53 Ga0105249_10203353 3300009553 Bacteria 1939
54 Ga0105249_10278885 3300009553 Bacteria 1668
55 Ga0105246_10052129 3300011119 Bacteria 2811
56 Ga0157378_10181874 3300013297 Unclassified 1978
57 Ga0163163_10093530 3300014325 Bacteria 3023
58 Ga0163163_10185961 3300014325 Bacteria 2125
59 Ga0182008_10140243 3300014497 Bacteria 1209
60 Ga0157379_10006081 3300014968 Bacteria 10393
61 Ga0157379_10288978 3300014968 Bacteria 1493
62 Ga0207684_10351628 3300025910 Unclassified 1268
63 Ga0207660_10000002 3300025917 Bacteria 883566
64 Ga0207662_10008416 3300025918 Bacteria 5647
65 Ga0207662_10475172 3300025918 Bacteria 858
66 Ga0207646_10026799 3300025922 Bacteria 5257
67 Ga0207646_10236709 3300025922 Bacteria 1650
68 Ga0207646_10541613 3300025922 Unclassified 1047
69 Ga0207646_10649713 3300025922 Unclassified 945
70 Ga0207687_10050759 3300025927 Bacteria 2889
71 Ga0207706_10257040 3300025933 Unclassified 1525
72 Ga0207669_10098158 3300025937 Bacteria 1928
73 Ga0207669_10285691 3300025937 Bacteria 1247
74 Ga0207711_10913378 3300025941 Bacteria 816
75 Ga0207661_10099523 3300025944 Bacteria 2439
76 Ga0207640_10205921 3300025981 Bacteria 1495
77 Ga0207708_10033665 3300026075 Bacteria 3895
78 Ga0207648_10212171 3300026089 Bacteria 1719
79 Ga0207676_10082332 3300026095 Bacteria 2617
80 Ga0209974_10015571 3300027876 Bacteria 2525
81 Ga0265337_1019796 3300028556 Bacteria 2116
82 Ga0265326_10007531 3300028558 Bacteria 3331
83 Ga0265334_10080928 3300028573 Bacteria 1196
84 Ga0265323_10076594 3300028653 Bacteria 1135
85 Ga0265338_10368397 3300028800 Bacteria 1029
86 Ga0265330_10101150 3300031235 Bacteria 1234
87 Ga0265316_10114090 3300031344 Bacteria 2044
88 Ga0265316_10212155 3300031344 Bacteria 1431
89 Ga0307408_100067249 3300031548 Bacteria 2635
90 Ga0265342_10107727 3300031712 Unclassified 1580
91 Ga0316576_10057175 3300031727 Bacteria 2850
92 Ga0316576_10094696 3300031727 Unclassified 2227
93 Ga0316576_10360291 3300031727 Bacteria 1081
94 Ga0316578_10009689 3300031728 Bacteria 4962
95 Ga0316578_10148375 3300031728 Bacteria 1413
96 Ga0316578_10248758 3300031728 Bacteria 1067
97 Ga0316577_10004951 3300031733 Bacteria 6945
98 Ga0307406_10264220 3300031901 Bacteria 1304
99 Ga0316583_10003466 3300032133 Bacteria 5554
100 Ga0316574_0064846 3300035398 Bacteria 2299
101 Ga0316574_0092532 3300035398 Bacteria 1930
102 Ga0316574_0200042 3300035398 Unclassified 1283
103 Ga0316574_0293915 3300035398 Bacteria 1034
104 Ga0316574_0386485 3300035398 Bacteria 882
105 Ga0316582_0023589 3300036647 Bacteria 3669
106 Ga0316582_0392751 3300036647 Bacteria 955
107 Ga0316584_0041801 3300036712 Bacteria 3417
108 Ga0316581_0039005 3300037588 Bacteria 1445
109 Ga0395901_0359857 3300038443 Bacteria 1501
110 Ga0436365_0151131 3300039437 Bacteria 4623
111 Ga0439465_0038304 3300041413 Bacteria 1544
112 Ga0439431_0108902 3300041997 Bacteria 766
113 Ga0450910_000913 3300042147 Bacteria 3568
114 Ga0450910_005660 3300042147 Bacteria 1711
115 Ga0439446_0089453 3300042156 Bacteria 962
116 Ga0451577_0066837 3300042876 Bacteria 3206
117 Ga0495592_0163834 3300046454 Unclassified 1528
118 Ga0495634_0046464 3300046642 Bacteria 2930
119 Ga0495674_0063442 3300047319 Bacteria 3214
120 Ga0495680_0581979 3300047322 Unclassified 751
121 Ga0495684_0190678 3300047471 Bacteria 1516
122 Ga0496104_0031707 3300048907 Bacteria 4916
123 Ga0496106_0014370 3300048909 Bacteria 5850
124 Ga0496107_0261142 3300048910 Bacteria 1289
125 Ga0496109_0101166 3300048912 Bacteria 2675
126 Ga0496112_0000001 3300048915 Bacteria 1346031
127 Ga0496112_0087709 3300048915 Bacteria 3079
128 Ga0501039_0344790 3300049575 Bacteria 1170
129 Ga0501068_0182741 3300049584 Bacteria 1326
130 Ga0501072_0238192 3300049588 Bacteria 1449
131 Ga0501075_0174406 3300049591 Bacteria 1641
132 Ga0501076_0290205 3300049592 Bacteria 1340
133 Ga0501081_0230789 3300049743 Bacteria 1348
134 nmdc:mga05p37_237_c1 3300050507 Bacteria 56213
135 nmdc:mga0n895_586943_c1 3300050512 Bacteria 1118
136 nmdc:mga0a205_15329_c2 3300050515 Bacteria 5165
137 Ga0501082_0083618 3300060353 Bacteria 2754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10475172 Ga0207662_104751722 180
2 3300049575 Ga0501039_0344790 Ga0501039_0344790_378_980 186
3 3300049592 Ga0501076_0290205 Ga0501076_0290205_573_1175 186
4 3300060353 Ga0501082_0083618 Ga0501082_0083618_1068_1670 186
5 3300031728 Ga0316578_10148375 Ga0316578_101483751 190
6 3300035398 Ga0316574_0386485 Ga0316574_0386485_110_748 190
7 3300049591 Ga0501075_0174406 Ga0501075_0174406_72_743 191
8 3300049743 Ga0501081_0230789 Ga0501081_0230789_165_836 191
9 3300005444 Ga0070694_100388672 Ga0070694_1003886721 194
10 3300046454 Ga0495592_0163834 Ga0495592_0163834_453_1103 195
11 3300046642 Ga0495634_0046464 Ga0495634_0046464_93_743 195
12 3300047319 Ga0495674_0063442 Ga0495674_0063442_17_667 195
13 3300047322 Ga0495680_0581979 Ga0495680_0581979_89_739 195
14 3300047471 Ga0495684_0190678 Ga0495684_0190678_126_776 195
15 3300009177 Ga0105248_10662735 Ga0105248_106627351 196
16 3300049588 Ga0501072_0238192 Ga0501072_0238192_685_1287 198
17 3300005356 Ga0070674_100018453 Ga0070674_1000184533 199
18 3300006881 Ga0068865_100070915 Ga0068865_1000709152 199
19 3300009148 Ga0105243_10192861 Ga0105243_101928612 199
20 3300009176 Ga0105242_10090387 Ga0105242_100903872 199
21 3300025937 Ga0207669_10098158 Ga0207669_100981582 199
22 3300039437 Ga0436365_0151131 Ga0436365_0151131_3896_4549 199
23 3300042876 Ga0451577_0066837 Ga0451577_0066837_1940_2632 199
24 3300014968 Ga0157379_10288978 Ga0157379_102889782 200
25 3300035398 Ga0316574_0200042 Ga0316574_0200042_534_1172 200
26 3300027876 Ga0209974_10015571 Ga0209974_100155712 203
27 3300042147 Ga0450910_000913 Ga0450910_000913_2171_2824 203
28 3300005615 Ga0070702_100255168 Ga0070702_1002551681 204
29 3300009148 Ga0105243_10196727 Ga0105243_101967272 204
30 3300009553 Ga0105249_10278885 Ga0105249_102788852 204
31 3300026089 Ga0207648_10212171 Ga0207648_102121712 204
32 3300028558 Ga0265326_10007531 Ga0265326_100075312 204
33 3300031712 Ga0265342_10107727 Ga0265342_101077271 204
34 3300041413 Ga0439465_0038304 Ga0439465_0038304_611_1264 204
35 3300025944 Ga0207661_10099523 Ga0207661_100995232 205
36 3300028653 Ga0265323_10076594 Ga0265323_100765942 206
37 3300031235 Ga0265330_10101150 Ga0265330_101011502 206
38 3300031344 Ga0265316_10212155 Ga0265316_102121552 206
39 3300049584 Ga0501068_0182741 Ga0501068_0182741_676_1314 206
40 3300014497 Ga0182008_10140243 Ga0182008_101402431 207
41 3300048912 Ga0496109_0101166 Ga0496109_0101166_700_1350 207
42 3300031727 Ga0316576_10094696 Ga0316576_100946962 209
43 3300031727 Ga0316576_10360291 Ga0316576_103602911 209
44 3300035398 Ga0316574_0064846 Ga0316574_0064846_1438_2067 209
45 3300038443 Ga0395901_0359857 Ga0395901_0359857_772_1416 209
46 3300003322 rootL2_10017933 rootL2_100179333 210
47 3300003323 rootH1_10291617 rootH1_102916172 210
48 3300005345 Ga0070692_10028127 Ga0070692_100281272 210
49 3300005356 Ga0070674_100149736 Ga0070674_1001497362 210
50 3300005457 Ga0070662_100089027 Ga0070662_1000890272 210
51 3300005530 Ga0070679_100790731 Ga0070679_1007907311 210
52 3300005546 Ga0070696_100251152 Ga0070696_1002511522 210
53 3300005843 Ga0068860_100763843 Ga0068860_1007638432 210
54 3300006881 Ga0068865_100178659 Ga0068865_1001786592 210
55 3300009553 Ga0105249_10203353 Ga0105249_102033531 210
56 3300014325 Ga0163163_10185961 Ga0163163_101859612 210
57 3300014968 Ga0157379_10006081 Ga0157379_100060812 210
58 3300025918 Ga0207662_10008416 Ga0207662_100084164 210
59 3300025937 Ga0207669_10285691 Ga0207669_102856911 210
60 3300025981 Ga0207640_10205921 Ga0207640_102059212 210
61 3300026075 Ga0207708_10033665 Ga0207708_100336653 210
62 3300026095 Ga0207676_10082332 Ga0207676_100823322 210
63 3300005458 Ga0070681_10738015 Ga0070681_107380151 211
64 3300005467 Ga0070706_100135863 Ga0070706_1001358632 211
65 3300005471 Ga0070698_100037986 Ga0070698_1000379863 211
66 3300005518 Ga0070699_100028950 Ga0070699_1000289501 211
67 3300005536 Ga0070697_100018299 Ga0070697_1000182995 211
68 3300025941 Ga0207711_10913378 Ga0207711_109133782 211
69 3300031548 Ga0307408_100067249 Ga0307408_1000672492 211
70 3300031727 Ga0316576_10057175 Ga0316576_100571752 211
71 3300031728 Ga0316578_10009689 Ga0316578_100096893 211
72 3300031901 Ga0307406_10264220 Ga0307406_102642201 211
73 3300035398 Ga0316574_0293915 Ga0316574_0293915_147_803 211
74 3300042156 Ga0439446_0089453 Ga0439446_0089453_165_806 211
75 3300005445 Ga0070708_100022411 Ga0070708_1000224115 212
76 3300006844 Ga0075428_100012778 Ga0075428_1000127784 212
77 3300031728 Ga0316578_10248758 Ga0316578_102487581 212
78 3300032133 Ga0316583_10003466 Ga0316583_100034665 212
79 3300035398 Ga0316574_0092532 Ga0316574_0092532_168_806 212
80 3300005336 Ga0070680_100750856 Ga0070680_1007508561 213
81 3300005547 Ga0070693_100382494 Ga0070693_1003824941 213
82 3300005615 Ga0070702_100401503 Ga0070702_1004015031 213
83 3300031733 Ga0316577_10004951 Ga0316577_100049513 213
84 3300036647 Ga0316582_0023589 Ga0316582_0023589_2163_2810 213
85 3300036647 Ga0316582_0392751 Ga0316582_0392751_198_845 213
86 3300036712 Ga0316584_0041801 Ga0316584_0041801_2487_3134 213
87 3300037588 Ga0316581_0039005 Ga0316581_0039005_238_885 213
88 3300048907 Ga0496104_0031707 Ga0496104_0031707_154_825 213
89 3300048910 Ga0496107_0261142 Ga0496107_0261142_62_712 213
90 3300048915 Ga0496112_0000001 Ga0496112_0000001_99154_99795 213
91 3300048915 Ga0496112_0087709 Ga0496112_0087709_1652_2308 213
92 3300028556 Ga0265337_1019796 Ga0265337_10197962 215
93 3300028573 Ga0265334_10080928 Ga0265334_100809282 215
94 3300028800 Ga0265338_10368397 Ga0265338_103683972 215
95 3300031344 Ga0265316_10114090 Ga0265316_101140902 215
96 3300005467 Ga0070706_100206846 Ga0070706_1002068461 216
97 3300006914 Ga0075436_100222089 Ga0075436_1002220892 216
98 3300009176 Ga0105242_10096938 Ga0105242_100969382 216
99 3300025933 Ga0207706_10257040 Ga0207706_102570402 216
100 3300050512 nmdc:mga0n895_586943_c1 nmdc:mga0n895_586943_c1_186_860 216
101 3300003320 rootH2_10003198 rootH2_100031982 217
102 3300005334 Ga0068869_100154298 Ga0068869_1001542982 217
103 3300005336 Ga0070680_100000002 Ga0070680_100000002109 217
104 3300005438 Ga0070701_10122507 Ga0070701_101225072 217
105 3300005440 Ga0070705_100018721 Ga0070705_1000187212 217
106 3300005440 Ga0070705_100123347 Ga0070705_1001233472 217
107 3300005445 Ga0070708_100005137 Ga0070708_1000051374 217
108 3300005467 Ga0070706_100027597 Ga0070706_1000275972 217
109 3300005467 Ga0070706_100064786 Ga0070706_1000647862 217
110 3300005468 Ga0070707_100008051 Ga0070707_1000080512 217
111 3300005468 Ga0070707_100068087 Ga0070707_1000680872 217
112 3300005518 Ga0070699_100094484 Ga0070699_1000944842 217
113 3300005518 Ga0070699_100634307 Ga0070699_1006343071 217
114 3300005536 Ga0070697_100163365 Ga0070697_1001633652 217
115 3300005546 Ga0070696_100027757 Ga0070696_1000277573 217
116 3300005546 Ga0070696_100537829 Ga0070696_1005378291 217
117 3300005617 Ga0068859_100426179 Ga0068859_1004261792 217
118 3300006175 Ga0070712_100378288 Ga0070712_1003782881 217
119 3300006852 Ga0075433_10061027 Ga0075433_100610272 217
120 3300006931 Ga0097620_100426226 Ga0097620_1004262262 217
121 3300009098 Ga0105245_10028712 Ga0105245_100287123 217
122 3300009147 Ga0114129_10003907 Ga0114129_100039073 217
123 3300011119 Ga0105246_10052129 Ga0105246_100521292 217
124 3300013297 Ga0157378_10181874 Ga0157378_101818742 217
125 3300014325 Ga0163163_10093530 Ga0163163_100935302 217
126 3300025910 Ga0207684_10351628 Ga0207684_103516281 217
127 3300025917 Ga0207660_10000002 Ga0207660_10000002541 217
128 3300025922 Ga0207646_10026799 Ga0207646_100267994 217
129 3300025922 Ga0207646_10236709 Ga0207646_102367091 217
130 3300025922 Ga0207646_10541613 Ga0207646_105416132 217
131 3300025922 Ga0207646_10649713 Ga0207646_106497131 217
132 3300025927 Ga0207687_10050759 Ga0207687_100507592 217
133 3300041997 Ga0439431_0108902 Ga0439431_0108902_97_750 217
134 3300042147 Ga0450910_005660 Ga0450910_005660_759_1412 217
135 3300048909 Ga0496106_0014370 Ga0496106_0014370_3592_4245 217
136 3300050507 nmdc:mga05p37_237_c1 nmdc:mga05p37_237_c1_7447_8187 217
137 3300050515 nmdc:mga0a205_15329_c2 nmdc:mga0a205_15329_c2_564_1217 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01478

Peptidase_A24

Type IV leader peptidase family

99

211

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a9e-assembly7.cif.gz_Q cryo-electron tomography and subtomogram averaging of rous-sarcoma- virus deltambd virus-like particles 0.2833 37 217
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.2781 39 212
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.2651 39 212
4knf-assembly1.cif.gz_B crystal structure of a blue-light absorbing proteorhodopsin double-mutant d97n/q105l from hot75 0.2564 3 212
3ez0-assembly1.cif.gz_B crystal structure of protein of unknown function with ferritin-like fold (yp_832262.1) from arthrobacter sp. fb24 at 2.33 a resolution 0.2437 3 179
ID Description Score Start End Superfamily
af_Q46836_122_264_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8219 69 211 1.20.120.1220
af_Q46836_122_264_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.786 69 211 1.20.120.1220
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7819 70 214 1.20.120.1220
af_I6Y9M6_1_137_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7622 71 211 1.20.120.1220
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7541 70 214 1.20.120.1220
ID Description Score Start End GO Terms
AF-A0A1F8S8U2-F1-model_v4 Prepilin type IV endopeptidase peptidase domain-containing protein 0.964 6 215 GO:0004190
GO:0005886
GO:0006465
AF-A0A535PAS6-F1-model_v4 Prepilin peptidase 0.9562 64 216 GO:0004190
GO:0005886
GO:0006465
AF-A0A535J1W1-F1-model_v4 Prepilin peptidase 0.9513 6 212 GO:0004190
GO:0005886
GO:0006465
AF-A0A1F8S8U2-F1-model_v4 Prepilin type IV endopeptidase peptidase domain-containing protein 0.9419 6 215 GO:0004190
GO:0005886
GO:0006465
AF-A0A536G6W7-F1-model_v4 Prepilin peptidase 0.937 6 215 GO:0004190
GO:0005886
GO:0006465

Feature Viewer

pLDDT pTM Quality
92.77 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map