F169293

General Info

Members Datasets Scaffolds Average Seq Length
137 104 274 305

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100002389|Ga0068860_1000023892
Length 293
Sequence MAHSTPDPNDEHGTVYDSLLGTDTSHWAFGTDFEDPLAGVDTTVPAELDAAELAAYCLALADDALVMSHRLSEWCSNAPDLEEDIALANIALDLLGQARLLLARAAAADPSVVPALPEVSPVPAEDALAFFREAVDFRNVRLVEVPNGDFAHTMARLLLFVTVRLAAFERLATPADPWSSDPVLAAIAAKGVKELAYHRDYSGRWFLTLAQGTEESRRRLLAGLAGIWPLYDELRTAYGVGPEADVVLDQVFAVSGVERPDEAPMAGTGHTEALSRLLAEMQVVARAHPEGLW

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
49 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
52 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
55 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
56 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
57 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
58 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
69 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
70 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
71 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
72 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
73 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
74 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
75 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
78 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
79 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
80 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
81 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
82 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
83 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
84 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
85 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
86 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
87 2643221604 Nocardioides sp. Root190 Isolate Unclassified
88 2643221617 Nocardioides sp. Root79 Isolate Unclassified
89 2643221620 Nocardioides sp. Root240 Isolate Unclassified
90 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
91 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
92 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
93 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
94 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
95 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
96 2739367898 Nocardioides sp. CF479 Isolate Unclassified
97 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
98 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
99 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
100 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
101 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
102 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
103 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
104 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.86
Metatranscriptomes 0
Isolates 13.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.55
Nodule 0.73
Rhizoplane 3.65
Rhizosphere 59.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100002389 3300005843 Bacteria 19704
2 JGI24744J21845_10009067 3300002077 Bacteria 2044
3 Ga0070658_10319449 3300005327 Bacteria 1326
4 Ga0068868_100301317 3300005338 Bacteria 1361
5 Ga0070691_10032872 3300005341 Bacteria 2438
6 Ga0070674_100010297 3300005356 Bacteria 5647
7 Ga0070659_100429207 3300005366 Bacteria 1118
8 Ga0070710_10000522 3300005437 Bacteria 18074
9 Ga0070700_100001852 3300005441 Bacteria 10666
10 Ga0070663_100279980 3300005455 Bacteria 1329
11 Ga0070663_100481202 3300005455 Bacteria 1028
12 Ga0070707_100021032 3300005468 Bacteria 6162
13 Ga0070698_100006706 3300005471 Bacteria 12489
14 Ga0070684_100065163 3300005535 Bacteria 3197
15 Ga0070672_100064903 3300005543 Bacteria 2886
16 Ga0070686_100069956 3300005544 Bacteria 2294
17 Ga0070695_100273103 3300005545 Bacteria 1239
18 Ga0070664_100097779 3300005564 Bacteria 2549
19 Ga0070664_100241432 3300005564 Bacteria 1622
20 Ga0068861_100095404 3300005719 Bacteria 2356
21 Ga0075365_10008294 3300006038 Bacteria 5887
22 Ga0075365_10014287 3300006038 Bacteria 4774
23 Ga0075365_10025915 3300006038 Bacteria 3716
24 Ga0075365_10034969 3300006038 Bacteria 3248
25 Ga0075365_10062190 3300006038 Bacteria 2496
26 Ga0075365_10080357 3300006038 Bacteria 2207
27 Ga0075365_10106575 3300006038 Bacteria 1923
28 Ga0075365_10205139 3300006038 Bacteria 1381
29 Ga0075365_10228675 3300006038 Bacteria 1305
30 Ga0075368_10003750 3300006042 Bacteria 5101
31 Ga0075368_10112772 3300006042 Bacteria 1122
32 Ga0075363_100000673 3300006048 Bacteria 11446
33 Ga0075363_100056669 3300006048 Bacteria 2101
34 Ga0075363_100088795 3300006048 Bacteria 1699
35 Ga0075363_100261971 3300006048 Bacteria 997
36 Ga0075364_10181767 3300006051 Bacteria 1423
37 Ga0075367_10001035 3300006178 Bacteria 11475
38 Ga0075367_10019518 3300006178 Bacteria 3760
39 Ga0075367_10097049 3300006178 Bacteria 1798
40 Ga0075367_10148048 3300006178 Bacteria 1456
41 Ga0075370_10041942 3300006353 Bacteria 2584
42 Ga0075428_100081771 3300006844 Bacteria 3525
43 Ga0105245_10049734 3300009098 Bacteria 3755
44 Ga0105243_10037818 3300009148 Bacteria 3755
45 Ga0105243_10071916 3300009148 Bacteria 2798
46 Ga0105243_10217336 3300009148 Bacteria 1687
47 Ga0105249_10130697 3300009553 Bacteria 2397
48 Ga0105246_10124440 3300011119 Bacteria 1916
49 Ga0157372_10188792 3300013307 Bacteria 2387
50 Ga0157375_10093003 3300013308 Bacteria 3080
51 Ga0157380_10228061 3300014326 Bacteria 1671
52 Ga0209051_1021169 3300025303 Bacteria 2778
53 Ga0207643_10001162 3300025908 Bacteria 15647
54 Ga0207659_10085536 3300025926 Bacteria 2343
55 Ga0207690_10234760 3300025932 Bacteria 1410
56 Ga0207669_10043371 3300025937 Bacteria 2634
57 Ga0207691_10000686 3300025940 Bacteria 33446
58 Ga0207661_10052962 3300025944 Bacteria 3245
59 Ga0207658_10015846 3300025986 Bacteria 5176
60 Ga0207677_10020844 3300026023 Bacteria 3992
61 Ga0207678_10336047 3300026067 Bacteria 1301
62 Ga0207708_10000075 3300026075 Bacteria 78540
63 Ga0207676_10145039 3300026095 Bacteria 2038
64 Ga0207675_100014243 3300026118 Bacteria 7412
65 Ga0207428_10065377 3300027907 Bacteria 2869
66 Ga0268264_10000639 3300028381 Bacteria 41587
67 Ga0373938_0015265 3300034957 Bacteria 1486
68 Ga0373961_0024551 3300035241 Bacteria 1632
69 Ga0395901_0144457 3300038443 Bacteria 2501
70 Ga0451806_031638 3300041462 Bacteria 1373
71 Ga0466965_0009172 3300044683 Bacteria 4596
72 Ga0466967_0044555 3300045976 Bacteria 3849
73 Ga0466967_0257051 3300045976 Bacteria 1670
74 Ga0466967_0449014 3300045976 Bacteria 1260
75 Ga0496103_0139298 3300048906 Bacteria 1551
76 Ga0496104_0354735 3300048907 Bacteria 1379
77 Ga0496109_0472751 3300048912 Bacteria 1184
78 Ga0496114_0005606 3300048917 Bacteria 9844
79 Ga0501031_0019697 3300049568 Bacteria 4396
80 Ga0501032_0031342 3300049569 Bacteria 3645
81 Ga0501033_0000203 3300049570 Bacteria 56963
82 Ga0501034_0241809 3300049571 Bacteria 1751
83 Ga0501036_0014204 3300049572 Bacteria 6625
84 Ga0501036_0087386 3300049572 Bacteria 2635
85 Ga0501037_0019269 3300049573 Bacteria 5030
86 Ga0501038_0011522 3300049574 Bacteria 8067
87 Ga0501038_0241446 3300049574 Bacteria 1434
88 Ga0501043_0023650 3300049579 Bacteria 4818
89 Ga0501046_0008066 3300049580 Bacteria 9201
90 Ga0501048_0017435 3300049582 Bacteria 5288
91 Ga0501067_0063438 3300049583 Bacteria 2046
92 Ga0501067_0074707 3300049583 Bacteria 1878
93 Ga0501067_0100434 3300049583 Bacteria 1607
94 Ga0501067_0122464 3300049583 Bacteria 1447
95 Ga0501068_0036473 3300049584 Bacteria 2940
96 Ga0501069_0032674 3300049585 Bacteria 2865
97 Ga0501069_0125151 3300049585 Bacteria 1470
98 Ga0501070_0020850 3300049586 Bacteria 5498
99 Ga0501073_0309940 3300049589 Bacteria 1089
100 Ga0501074_0365546 3300049590 Bacteria 1024
101 Ga0501076_0207731 3300049592 Bacteria 1600
102 Ga0501079_0242949 3300049741 Bacteria 1407
103 Ga0501080_0031743 3300049742 Bacteria 4922
104 Ga0501045_0202056 3300049824 Bacteria 1481
105 nmdc:mga03n38_149442_c1 3300050490 Bacteria 1174
106 nmdc:mga03n38_88529_c1 3300050490 Bacteria 1469
107 nmdc:mga0yw44_10560_c1 3300050492 Bacteria 4725
108 nmdc:mga0yw44_157760_c1 3300050492 Bacteria 1484
109 nmdc:mga0yw44_204392_c1 3300050492 Bacteria 1305
110 nmdc:mga0yw44_208982_c1 3300050492 Bacteria 1291
111 nmdc:mga0yw44_32197_c1 3300050492 Bacteria 3054
112 nmdc:mga06z11_5824_c1 3300050494 Bacteria 4973
113 nmdc:mga07m45_31365_c1 3300050496 Bacteria 2946
114 nmdc:mga07m45_63945_c1 3300050496 Bacteria 2087
115 nmdc:mga08y16_369409_c1 3300050511 Bacteria 1472
116 Ga0500641_0002265 3300053096 Bacteria 6821
117 Ga0500593_000077 3300053117 Bacteria 36560
118 Ga0500573_0002950 3300053140 Bacteria 8678
119 Ga0530510_0200674 3300061734 Bacteria 1481
120 2644031887 2643221604 Bacteria 5014917
121 2644102814 2643221617 Bacteria 5139111
122 2644118476 2643221620 Bacteria 5134593
123 2644138114 2643221624 Bacteria 4384879
124 2644539122 2643221697 Bacteria 3575694
125 2645722381 2643221961 Bacteria 3919167
126 2645725358 2643221962 Bacteria 3874254
127 2738696288 2738541272 Bacteria 6848551
128 2739325419 2738543027 Bacteria 6409078
129 2740167560 2739367898 Bacteria 4367674
130 2760303463 2758568522 Bacteria 5953541
131 2760623857 2758568621 Bacteria 5967089
132 2857485223 2857481737 Bacteria 4761446
133 2891330474 2891326441 Bacteria 6439512
134 2919448312 2919446982 Bacteria 3994487
135 3002999356 3002998708 Bacteria 11715108
136 8054613134 8054609563 Bacteria 5170090
137 8056582509 8056579771 Bacteria 5840325
138 Ga0068860_100002389
139 JGI24744J21845_10009067
140 Ga0070658_10319449
141 Ga0068868_100301317
142 Ga0070691_10032872
143 Ga0070674_100010297
144 Ga0070659_100429207
145 Ga0070710_10000522
146 Ga0070700_100001852
147 Ga0070663_100279980
148 Ga0070663_100481202
149 Ga0070707_100021032
150 Ga0070698_100006706
151 Ga0070684_100065163
152 Ga0070672_100064903
153 Ga0070686_100069956
154 Ga0070695_100273103
155 Ga0070664_100097779
156 Ga0070664_100241432
157 Ga0068861_100095404
158 Ga0075365_10008294
159 Ga0075365_10014287
160 Ga0075365_10025915
161 Ga0075365_10034969
162 Ga0075365_10062190
163 Ga0075365_10080357
164 Ga0075365_10106575
165 Ga0075365_10205139
166 Ga0075365_10228675
167 Ga0075368_10003750
168 Ga0075368_10112772
169 Ga0075363_100000673
170 Ga0075363_100056669
171 Ga0075363_100088795
172 Ga0075363_100261971
173 Ga0075364_10181767
174 Ga0075367_10001035
175 Ga0075367_10019518
176 Ga0075367_10097049
177 Ga0075367_10148048
178 Ga0075370_10041942
179 Ga0075428_100081771
180 Ga0105245_10049734
181 Ga0105243_10037818
182 Ga0105243_10071916
183 Ga0105243_10217336
184 Ga0105249_10130697
185 Ga0105246_10124440
186 Ga0157372_10188792
187 Ga0157375_10093003
188 Ga0157380_10228061
189 Ga0209051_1021169
190 Ga0207643_10001162
191 Ga0207659_10085536
192 Ga0207690_10234760
193 Ga0207669_10043371
194 Ga0207691_10000686
195 Ga0207661_10052962
196 Ga0207658_10015846
197 Ga0207677_10020844
198 Ga0207678_10336047
199 Ga0207708_10000075
200 Ga0207676_10145039
201 Ga0207675_100014243
202 Ga0207428_10065377
203 Ga0268264_10000639
204 Ga0373938_0015265
205 Ga0373961_0024551
206 Ga0395901_0144457
207 Ga0451806_031638
208 Ga0466965_0009172
209 Ga0466967_0044555
210 Ga0466967_0257051
211 Ga0466967_0449014
212 Ga0496103_0139298
213 Ga0496104_0354735
214 Ga0496109_0472751
215 Ga0496114_0005606
216 Ga0501031_0019697
217 Ga0501032_0031342
218 Ga0501033_0000203
219 Ga0501034_0241809
220 Ga0501036_0014204
221 Ga0501036_0087386
222 Ga0501037_0019269
223 Ga0501038_0011522
224 Ga0501038_0241446
225 Ga0501043_0023650
226 Ga0501046_0008066
227 Ga0501048_0017435
228 Ga0501067_0063438
229 Ga0501067_0074707
230 Ga0501067_0100434
231 Ga0501067_0122464
232 Ga0501068_0036473
233 Ga0501069_0032674
234 Ga0501069_0125151
235 Ga0501070_0020850
236 Ga0501073_0309940
237 Ga0501074_0365546
238 Ga0501076_0207731
239 Ga0501079_0242949
240 Ga0501080_0031743
241 Ga0501045_0202056
242 nmdc:mga03n38_149442_c1
243 nmdc:mga03n38_88529_c1
244 nmdc:mga0yw44_10560_c1
245 nmdc:mga0yw44_157760_c1
246 nmdc:mga0yw44_204392_c1
247 nmdc:mga0yw44_208982_c1
248 nmdc:mga0yw44_32197_c1
249 nmdc:mga06z11_5824_c1
250 nmdc:mga07m45_31365_c1
251 nmdc:mga07m45_63945_c1
252 nmdc:mga08y16_369409_c1
253 Ga0500641_0002265
254 Ga0500593_000077
255 Ga0500573_0002950
256 Ga0530510_0200674
257 2644031887
258 2644102814
259 2644118476
260 2644138114
261 2644539122
262 2645722381
263 2645725358
264 2738696288
265 2739325419
266 2740167560
267 2760303463
268 2760623857
269 2857485223
270 2891330474
271 2919448312
272 3002999356
273 8054613134
274 8056582509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

38

293

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.9642 57 303
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.9534 54 314
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.9521 57 303
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.9459 54 314
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.9403 54 314
ID Description Score Start End Superfamily
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9497 54 314 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9385 54 314 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8064 46 274 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7859 45 308 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7799 46 274 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A3D0ZKV3-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9976 163 260 GO:0005829
GO:0010124
AF-A0A6N8PLU7-F1-model_v4 deleted 0.981 151 276
AF-A0A0K2R734-F1-model_v4 deleted 0.9725 53 311
AF-A0A376MXU8-F1-model_v4 Multicomponent oxygenase/reductase subunit for phenylacetic acid degradation 0.9718 54 252 GO:0005829
GO:0010124
AF-A0A6L7CNZ6-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaC 0.9698 55 220 GO:0005829
GO:0010124

Map