F167813

General Info

Members Datasets Scaffolds Average Seq Length
136 111 129 285

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0068806|Ga0496112_0068806_421_1368
Length 307
Sequence LTFDGCGSLIRETQENPAGKIAPMKASAFDYARATSVDDALRLLAALGPAAKVLAGGQSLMPAMNLRLISPDFVVDIGGLSELKGIAVRGSTLHIGALTRHADLMRSSEIAAVAHVAHPAIRNRGTIGGSLAHADPAAELPACMLALDAAIIARGSRGERRIPAGNFFTGIFETALKGDELLVAVEIPIAQKNSVHFFQEFARRHGDYAIAGLAGQGIIEGGQLADLRLAYFAVEDRPILAKAAGKFVNVAVTPALVLEASRALAEELDPHEDQQASSTMRRHLAKVLLTRAIAALLERPELAGAAL

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
3 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
4 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
5 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
29 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
30 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
56 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
57 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
88 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
104 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
105 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
106 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
107 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
108 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
109 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
110 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
111 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 0
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.35
Nodule 6.62
Rhizoplane 8.82
Rhizosphere 67.65
Stem 0
Stem Tuber 0
Unclassified 9.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10181802 3300003323 Bacteria 1901
2 Ga0070683_100007227 3300005329 Bacteria 9370
3 Ga0070683_100067457 3300005329 Bacteria 3332
4 Ga0070683_100535110 3300005329 Bacteria 1120
5 Ga0070680_100115829 3300005336 Bacteria 2234
6 Ga0070709_10004313 3300005434 Bacteria 7667
7 Ga0070709_10064251 3300005434 Bacteria 2347
8 Ga0070714_100056956 3300005435 Bacteria 3344
9 Ga0070713_100118438 3300005436 Bacteria 2319
10 Ga0070713_100285831 3300005436 Bacteria 1514
11 Ga0070710_10192280 3300005437 Bacteria 1284
12 Ga0070708_100098228 3300005445 Bacteria 2677
13 Ga0070681_10084622 3300005458 Bacteria 3124
14 Ga0070681_10113640 3300005458 Bacteria 2647
15 Ga0070679_100014293 3300005530 Bacteria 7623
16 Ga0070679_100147397 3300005530 Bacteria 2331
17 Ga0070684_100010214 3300005535 Bacteria 7429
18 Ga0070684_100270282 3300005535 Bacteria 1556
19 Ga0068853_100071086 3300005539 Bacteria 3030
20 Ga0070665_100071499 3300005548 Bacteria 3476
21 Ga0070665_100102566 3300005548 Bacteria 2864
22 Ga0068855_100062330 3300005563 Bacteria 4353
23 Ga0068855_100158996 3300005563 Bacteria 2566
24 Ga0068854_100280123 3300005578 Bacteria 1342
25 Ga0068852_100008748 3300005616 Bacteria 7487
26 Ga0068858_100042194 3300005842 Bacteria 4230
27 Ga0081455_10027486 3300005937 Bacteria 5214
28 Ga0081455_10043147 3300005937 Bacteria 3949
29 Ga0081540_1034213 3300005983 Bacteria 2745
30 Ga0081540_1108691 3300005983 Bacteria 1178
31 Ga0070717_10000620 3300006028 Bacteria 22822
32 Ga0075368_10020278 3300006042 Bacteria 2516
33 Ga0075367_10309507 3300006178 Bacteria 995
34 Ga0099825_1024280 3300006941 Bacteria 3573
35 Ga0099824_1013434 3300006942 Bacteria 8497
36 Ga0099822_1002066 3300006943 Bacteria 24562
37 Ga0105240_10057601 3300009093 Bacteria 4853
38 Ga0105245_10151122 3300009098 Bacteria 2196
39 Ga0105241_10021404 3300009174 Bacteria 4780
40 Ga0105248_10123329 3300009177 Bacteria 2923
41 Ga0105248_10528733 3300009177 Bacteria 1330
42 Ga0105237_10012648 3300009545 Bacteria 8884
43 Ga0105237_10056690 3300009545 Bacteria 3921
44 Ga0105238_10000813 3300009551 Bacteria 32330
45 Ga0105239_10010234 3300010375 Bacteria 10503
46 Ga0105239_10019242 3300010375 Bacteria 7541
47 Ga0105239_10064199 3300010375 Bacteria 4031
48 Ga0157370_10059395 3300013104 Bacteria 3634
49 Ga0157370_10128371 3300013104 Bacteria 2366
50 Ga0157374_10008339 3300013296 Bacteria 8845
51 Ga0157379_10123151 3300014968 Bacteria 2333
52 Ga0157379_10207878 3300014968 Bacteria 1771
53 Ga0213872_10007200 3300021361 Bacteria 5499
54 Ga0209148_1000474 3300025254 Bacteria 42596
55 Ga0209233_1008194 3300025261 Bacteria 3253
56 Ga0207705_10404024 3300025909 Bacteria 1057
57 Ga0207654_10015740 3300025911 Bacteria 3930
58 Ga0207707_10078526 3300025912 Bacteria 2882
59 Ga0207671_10009312 3300025914 Bacteria 8222
60 Ga0207671_10087272 3300025914 Bacteria 2346
61 Ga0207652_10033130 3300025921 Bacteria 4348
62 Ga0207652_10118196 3300025921 Bacteria 2356
63 Ga0207694_10015474 3300025924 Bacteria 5753
64 Ga0207700_10016181 3300025928 Bacteria 4947
65 Ga0207665_10054676 3300025939 Bacteria 2692
66 Ga0207711_10115615 3300025941 Bacteria 2391
67 Ga0207711_10467078 3300025941 Bacteria 1175
68 Ga0207640_10142193 3300025981 Bacteria 1751
69 Ga0207702_10290872 3300026078 Bacteria 1548
70 Ga0209589_1000004 3300027357 Bacteria 578529
71 Ga0209489_100004 3300027361 Bacteria 578529
72 Ga0209700_100004 3300027363 Bacteria 578529
73 Ga0268266_10081876 3300028379 Bacteria 2815
74 Ga0268266_10147292 3300028379 Bacteria 2118
75 Ga0307517_10000756 3300028786 Bacteria 55661
76 Ga0307515_10016019 3300028794 Bacteria 13759
77 Ga0307508_10000025 3300031616 Bacteria 174642
78 Ga0307516_10137383 3300031730 Bacteria 2217
79 Ga0307510_10042569 3300033180 Bacteria 4947
80 Ga0373931_0076805 3300035691 Bacteria 1835
81 Ga0373927_0073603 3300035695 Bacteria 2212
82 Ga0373933_0000052 3300035724 Bacteria 70592
83 Ga0373947_0029897 3300035725 Bacteria 3198
84 Ga0373925_0028774 3300037068 Bacteria 4073
85 Ga0373925_0142672 3300037068 Bacteria 1876
86 Ga0395898_0097888 3300037466 Bacteria 2817
87 Ga0395905_0023969 3300037471 Bacteria 5762
88 Ga0436364_0255805 3300037853 Bacteria 7407
89 Ga0436361_0091231 3300039447 Bacteria 12775
90 Ga0466966_0149698 3300044684 Bacteria 1424
91 Ga0466963_0138494 3300044694 Bacteria 1685
92 Ga0466968_0201312 3300044735 Unclassified 933
93 Ga0466959_0007200 3300045049 Bacteria 7793
94 Ga0466959_0069466 3300045049 Bacteria 2552
95 Ga0495592_0011943 3300046454 Bacteria 6583
96 Ga0495603_0097591 3300046455 Bacteria 1716
97 Ga0495664_0005049 3300046477 Bacteria 7229
98 Ga0495610_0065336 3300046512 Bacteria 1717
99 Ga0495648_0011737 3300046524 Bacteria 6573
100 Ga0495645_0022119 3300046543 Bacteria 4599
101 Ga0495625_0102718 3300046660 Bacteria 1962
102 Ga0495599_0035459 3300046678 Bacteria 3132
103 Ga0495581_0031392 3300047315 Bacteria 3079
104 Ga0495674_0334274 3300047319 Bacteria 1232
105 Ga0495672_0014325 3300047320 Bacteria 5435
106 Ga0495626_0198926 3300048091 Bacteria 823
107 Ga0496101_0152995 3300048904 Bacteria 1765
108 Ga0496102_0008961 3300048905 Bacteria 8584
109 Ga0496104_0018238 3300048907 Bacteria 6402
110 Ga0496106_0008772 3300048909 Bacteria 7471
111 Ga0496107_0029976 3300048910 Bacteria 3875
112 Ga0496108_0060114 3300048911 Bacteria 3197
113 Ga0496110_0057387 3300048913 Bacteria 3427
114 Ga0496111_0054329 3300048914 Bacteria 2895
115 Ga0496111_0172318 3300048914 Bacteria 1608
116 Ga0496112_0068806 3300048915 Bacteria 3497
117 Ga0496114_0182229 3300048917 Bacteria 1834
118 Ga0496115_0087145 3300048918 Bacteria 2548
119 Ga0496121_0301942 3300048924 Bacteria 1086
120 Ga0496126_0007210 3300048929 Bacteria 12229
121 Ga0501069_0134891 3300049585 Bacteria 1415
122 nmdc:mga0yw44_112107_c1 3300050492 Bacteria 1749
123 nmdc:mga06z11_268119_c1 3300050494 Bacteria 1009
124 nmdc:mga06z11_48461_c1 3300050494 Bacteria 2162
125 Ga0495601_0006041 3300053077 Bacteria 7064
126 Ga0495612_0006699 3300053078 Bacteria 4719
127 Ga0500554_008630 3300053102 Bacteria 2405
128 Ga0500568_0069059 3300053139 Bacteria 1356
129 Ga0500636_0123535 3300053177 Bacteria 1450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053177 Ga0500636_0123535 Ga0500636_0123535_659_1429 208
2 3300026078 Ga0207702_10290872 Ga0207702_102908722 213
3 3300048091 Ga0495626_0198926 Ga0495626_0198926_18_761 213
4 3300048914 Ga0496111_0172318 Ga0496111_0172318_273_1154 213
5 3300006178 Ga0075367_10309507 Ga0075367_103095072 222
6 3300050494 nmdc:mga06z11_268119_c1 nmdc:mga06z11_268119_c1_213_983 222
7 3300053102 Ga0500554_008630 Ga0500554_008630_57_899 230
8 3300044684 Ga0466966_0149698 Ga0466966_0149698_159_965 233
9 3300045049 Ga0466959_0069466 Ga0466959_0069466_824_1630 233
10 3300005435 Ga0070714_100056956 Ga0070714_1000569562 234
11 3300005436 Ga0070713_100118438 Ga0070713_1001184383 234
12 3300006028 Ga0070717_10000620 Ga0070717_1000062018 234
13 3300025928 Ga0207700_10016181 Ga0207700_100161812 234
14 3300044735 Ga0466968_0201312 Ga0466968_0201312_14_835 239
15 3300005548 Ga0070665_100102566 Ga0070665_1001025662 248
16 3300005937 Ga0081455_10043147 Ga0081455_100431473 248
17 3300028379 Ga0268266_10081876 Ga0268266_100818763 249
18 3300047320 Ga0495672_0014325 Ga0495672_0014325_2030_2911 252
19 3300048929 Ga0496126_0007210 Ga0496126_0007210_5225_6103 252
20 3300035724 Ga0373933_0000052 Ga0373933_0000052_13265_14143 253
21 3300021361 Ga0213872_10007200 Ga0213872_100072004 254
22 3300039447 Ga0436361_0091231 Ga0436361_0091231_11851_12717 254
23 iso_pu_bacteria 2508501128 2509148685 254
24 iso_pu_bacteria 2517093001 2517105446 255
25 iso_pu_bacteria 2844315083 2844319546 255
26 iso_pu_bacteria 2903727486 2903734483 255
27 iso_pu_bacteria 2906602504 2906609278 255
28 iso_pu_bacteria 8006926726 8006932353 255
29 iso_pu_bacteria 8056967851 8056968522 255
30 3300033180 Ga0307510_10042569 Ga0307510_100425696 257
31 3300046524 Ga0495648_0011737 Ga0495648_0011737_2787_3662 257
32 3300005329 Ga0070683_100067457 Ga0070683_1000674573 258
33 3300005329 Ga0070683_100535110 Ga0070683_1005351102 258
34 3300005434 Ga0070709_10064251 Ga0070709_100642512 258
35 3300005458 Ga0070681_10113640 Ga0070681_101136402 258
36 3300005530 Ga0070679_100147397 Ga0070679_1001473972 258
37 3300005535 Ga0070684_100010214 Ga0070684_1000102144 258
38 3300005535 Ga0070684_100270282 Ga0070684_1002702822 258
39 3300005539 Ga0068853_100071086 Ga0068853_1000710862 258
40 3300005548 Ga0070665_100071499 Ga0070665_1000714993 258
41 3300005563 Ga0068855_100158996 Ga0068855_1001589963 258
42 3300005578 Ga0068854_100280123 Ga0068854_1002801231 258
43 3300009545 Ga0105237_10056690 Ga0105237_100566903 258
44 3300009551 Ga0105238_10000813 Ga0105238_100008135 258
45 3300010375 Ga0105239_10010234 Ga0105239_100102342 258
46 3300013104 Ga0157370_10059395 Ga0157370_100593953 258
47 3300013296 Ga0157374_10008339 Ga0157374_100083392 258
48 3300025914 Ga0207671_10087272 Ga0207671_100872723 258
49 3300025921 Ga0207652_10118196 Ga0207652_101181962 258
50 3300025924 Ga0207694_10015474 Ga0207694_100154742 258
51 3300025981 Ga0207640_10142193 Ga0207640_101421932 258
52 3300028379 Ga0268266_10147292 Ga0268266_101472922 258
53 3300031616 Ga0307508_10000025 Ga0307508_1000002528 258
54 3300037853 Ga0436364_0255805 Ga0436364_0255805_872_1750 258
55 3300044694 Ga0466963_0138494 Ga0466963_0138494_286_1164 258
56 3300045049 Ga0466959_0007200 Ga0466959_0007200_2168_3046 258
57 3300046477 Ga0495664_0005049 Ga0495664_0005049_1458_2336 258
58 3300046543 Ga0495645_0022119 Ga0495645_0022119_2576_3454 258
59 3300046678 Ga0495599_0035459 Ga0495599_0035459_1677_2555 258
60 3300047319 Ga0495674_0334274 Ga0495674_0334274_191_1069 258
61 3300048915 Ga0496112_0068806 Ga0496112_0068806_421_1368 258
62 3300048918 Ga0496115_0087145 Ga0496115_0087145_861_1739 258
63 3300049585 Ga0501069_0134891 Ga0501069_0134891_234_1112 258
64 3300053077 Ga0495601_0006041 Ga0495601_0006041_5126_6004 258
65 3300053078 Ga0495612_0006699 Ga0495612_0006699_2550_3428 258
66 3300003323 rootH1_10181802 rootH1_101818022 259
67 3300005329 Ga0070683_100007227 Ga0070683_1000072275 259
68 3300005336 Ga0070680_100115829 Ga0070680_1001158292 259
69 3300005434 Ga0070709_10004313 Ga0070709_100043136 259
70 3300005436 Ga0070713_100285831 Ga0070713_1002858312 259
71 3300005437 Ga0070710_10192280 Ga0070710_101922802 259
72 3300005445 Ga0070708_100098228 Ga0070708_1000982281 259
73 3300005458 Ga0070681_10084622 Ga0070681_100846223 259
74 3300005530 Ga0070679_100014293 Ga0070679_1000142932 259
75 3300005563 Ga0068855_100062330 Ga0068855_1000623302 259
76 3300005616 Ga0068852_100008748 Ga0068852_1000087484 259
77 3300005842 Ga0068858_100042194 Ga0068858_1000421941 259
78 3300005937 Ga0081455_10027486 Ga0081455_100274864 259
79 3300005983 Ga0081540_1034213 Ga0081540_10342133 259
80 3300005983 Ga0081540_1108691 Ga0081540_11086912 259
81 3300006042 Ga0075368_10020278 Ga0075368_100202783 259
82 3300006941 Ga0099825_1024280 Ga0099825_10242803 259
83 3300006942 Ga0099824_1013434 Ga0099824_10134345 259
84 3300006943 Ga0099822_1002066 Ga0099822_100206622 259
85 3300009093 Ga0105240_10057601 Ga0105240_100576014 259
86 3300009098 Ga0105245_10151122 Ga0105245_101511222 259
87 3300009174 Ga0105241_10021404 Ga0105241_100214043 259
88 3300009177 Ga0105248_10123329 Ga0105248_101233293 259
89 3300009177 Ga0105248_10528733 Ga0105248_105287332 259
90 3300009545 Ga0105237_10012648 Ga0105237_100126483 259
91 3300010375 Ga0105239_10019242 Ga0105239_100192424 259
92 3300010375 Ga0105239_10064199 Ga0105239_100641992 259
93 3300013104 Ga0157370_10128371 Ga0157370_101283712 259
94 3300014968 Ga0157379_10123151 Ga0157379_101231512 259
95 3300014968 Ga0157379_10207878 Ga0157379_102078782 259
96 3300025254 Ga0209148_1000474 Ga0209148_100047433 259
97 3300025261 Ga0209233_1008194 Ga0209233_10081943 259
98 3300025909 Ga0207705_10404024 Ga0207705_104040242 259
99 3300025911 Ga0207654_10015740 Ga0207654_100157402 259
100 3300025912 Ga0207707_10078526 Ga0207707_100785263 259
101 3300025914 Ga0207671_10009312 Ga0207671_100093122 259
102 3300025921 Ga0207652_10033130 Ga0207652_100331302 259
103 3300025939 Ga0207665_10054676 Ga0207665_100546762 259
104 3300025941 Ga0207711_10115615 Ga0207711_101156152 259
105 3300025941 Ga0207711_10467078 Ga0207711_104670781 259
106 3300027357 Ga0209589_1000004 Ga0209589_1000004169 259
107 3300027361 Ga0209489_100004 Ga0209489_100004169 259
108 3300027363 Ga0209700_100004 Ga0209700_100004169 259
109 3300028786 Ga0307517_10000756 Ga0307517_1000075619 259
110 3300028794 Ga0307515_10016019 Ga0307515_100160196 259
111 3300031730 Ga0307516_10137383 Ga0307516_101373832 259
112 3300035691 Ga0373931_0076805 Ga0373931_0076805_188_1069 259
113 3300035695 Ga0373927_0073603 Ga0373927_0073603_160_1041 259
114 3300035725 Ga0373947_0029897 Ga0373947_0029897_219_1100 259
115 3300037068 Ga0373925_0028774 Ga0373925_0028774_1491_2372 259
116 3300037068 Ga0373925_0142672 Ga0373925_0142672_327_1208 259
117 3300037466 Ga0395898_0097888 Ga0395898_0097888_751_1632 259
118 3300037471 Ga0395905_0023969 Ga0395905_0023969_583_1464 259
119 3300046454 Ga0495592_0011943 Ga0495592_0011943_1299_2222 259
120 3300046455 Ga0495603_0097591 Ga0495603_0097591_571_1452 259
121 3300046512 Ga0495610_0065336 Ga0495610_0065336_517_1398 259
122 3300046660 Ga0495625_0102718 Ga0495625_0102718_822_1703 259
123 3300047315 Ga0495581_0031392 Ga0495581_0031392_310_1191 259
124 3300048904 Ga0496101_0152995 Ga0496101_0152995_121_1002 259
125 3300048905 Ga0496102_0008961 Ga0496102_0008961_1362_2243 259
126 3300048907 Ga0496104_0018238 Ga0496104_0018238_1215_2096 259
127 3300048909 Ga0496106_0008772 Ga0496106_0008772_4937_5818 259
128 3300048910 Ga0496107_0029976 Ga0496107_0029976_1358_2239 259
129 3300048911 Ga0496108_0060114 Ga0496108_0060114_431_1312 259
130 3300048913 Ga0496110_0057387 Ga0496110_0057387_2333_3214 259
131 3300048914 Ga0496111_0054329 Ga0496111_0054329_1823_2704 259
132 3300048917 Ga0496114_0182229 Ga0496114_0182229_216_1097 259
133 3300048924 Ga0496121_0301942 Ga0496121_0301942_87_1004 259
134 3300050492 nmdc:mga0yw44_112107_c1 nmdc:mga0yw44_112107_c1_277_1158 259
135 3300050494 nmdc:mga06z11_48461_c1 nmdc:mga06z11_48461_c1_665_1579 259
136 3300053139 Ga0500568_0069059 Ga0500568_0069059_403_1284 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

27

190

0.97

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

196

296

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9447 6 250
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.9412 5 250
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9371 6 248
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9371 6 248
7dqx-assembly1.cif.gz_B crystal structure of xanthine dehydrogenase family protein 0.9264 5 245
ID Description Score Start End Superfamily
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.955 60 139 3.30.465.10
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9535 74 139 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9395 58 141 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.937 60 139 3.30.465.10
af_Q46800_56_173_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9285 58 139 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A1J5P589-F1-model_v4 Carbon monoxide dehydrogenase medium chain (EC 1.2.99.2) 0.9672 95 259 GO:0016491
GO:0050660
AF-A0A1J5P589-F1-model_v4 Carbon monoxide dehydrogenase medium chain (EC 1.2.99.2) 0.9615 95 259 GO:0016491
GO:0050660
AF-A0A1H1U904-F1-model_v4 Carbon-monoxide dehydrogenase medium subunit 0.957 1 258 GO:0016491
GO:0071949
AF-A0A7C9RJ89-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9529 1 259 GO:0016491
GO:0071949
AF-A0A1H1U904-F1-model_v4 Carbon-monoxide dehydrogenase medium subunit 0.9498 1 258 GO:0016491
GO:0071949

Feature Viewer

pLDDT pTM Quality
87.49 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map