F166603

General Info

Members Datasets Scaffolds Average Seq Length
136 83 135 167

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10152242|Ga0157374_101522422
Length 180
Sequence MRGQGHRSAASQPKNFMPEDIFDVVNERDEVIDSKPRSEVHRLGLLHRAVHVLVFNARGQVFLQKRSMKKDRQPGVWDSSASGHVDSGEDYDTTAVREVWEEIGLRLDKTPARLFKIEACEETDQEFVWVYRCESEGPFKLHPDEIDEGGWFSPDEVSRWMAQKPEEFATALLYIWSRIK

Samples

Sample ID Description Type Environment
1 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
48 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
49 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
63 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
64 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
65 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
66 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
71 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
76 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
77 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
83 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.68
Rhizosphere 92.65
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10316051 3300003320 Unclassified 1374
2 rootH1_10261486 3300003323 Bacteria 1030
3 rootH1_10276205 3300003323 Unclassified 1160
4 Ga0070658_10301342 3300005327 Unclassified 1366
5 Ga0070690_100000827 3300005330 Bacteria 15721
6 Ga0070690_100932029 3300005330 Unclassified 681
7 Ga0070660_100352129 3300005339 Bacteria 1213
8 Ga0070689_100005353 3300005340 Bacteria 8753
9 Ga0070689_100096030 3300005340 Bacteria 2342
10 Ga0070691_10038925 3300005341 Bacteria 2246
11 Ga0070714_100006920 3300005435 Bacteria 8793
12 Ga0070713_100881392 3300005436 Unclassified 860
13 Ga0070681_10020412 3300005458 Bacteria 6640
14 Ga0070685_10275014 3300005466 Unclassified 1125
15 Ga0070679_100310114 3300005530 Bacteria 1528
16 Ga0070679_100524790 3300005530 Bacteria 1128
17 Ga0070679_100565281 3300005530 Unclassified 1081
18 Ga0068855_100078028 3300005563 Bacteria 3842
19 Ga0068855_100586518 3300005563 Unclassified 1203
20 Ga0068855_100769814 3300005563 Bacteria 1025
21 Ga0068855_100802726 3300005563 Bacteria 1000
22 Ga0068863_100809224 3300005841 Unclassified 935
23 Ga0068858_100088497 3300005842 Bacteria 2881
24 Ga0070717_10252270 3300006028 Bacteria 1559
25 Ga0097621_100227588 3300006237 Bacteria 1627
26 Ga0097621_100488525 3300006237 Bacteria 1114
27 Ga0105240_10038865 3300009093 Bacteria 6101
28 Ga0105240_10059833 3300009093 Bacteria 4752
29 Ga0105240_10183508 3300009093 Bacteria 2467
30 Ga0105240_10518167 3300009093 Bacteria 1324
31 Ga0105241_10046615 3300009174 Bacteria 3292
32 Ga0105241_11385202 3300009174 Unclassified 673
33 Ga0105242_11280049 3300009176 Bacteria 756
34 Ga0105248_10854208 3300009177 Unclassified 1027
35 Ga0105237_11212135 3300009545 Bacteria 761
36 Ga0105238_10923843 3300009551 Unclassified 892
37 Ga0105238_11065886 3300009551 Bacteria 830
38 Ga0157370_10046507 3300013104 Bacteria 4161
39 Ga0157370_10140210 3300013104 Bacteria 2253
40 Ga0157374_10152242 3300013296 Bacteria 2249
41 Ga0157374_11954955 3300013296 Unclassified 613
42 Ga0157378_10034072 3300013297 Unclassified 4504
43 Ga0157372_10033868 3300013307 Bacteria 5614
44 Ga0157372_10176612 3300013307 Bacteria 2472
45 Ga0207705_10037109 3300025909 Unclassified 3487
46 Ga0207707_10084194 3300025912 Unclassified 2777
47 Ga0207707_10164198 3300025912 Bacteria 1941
48 Ga0207695_10084477 3300025913 Bacteria 3205
49 Ga0207657_10570317 3300025919 Unclassified 884
50 Ga0207652_10162818 3300025921 Bacteria 2000
51 Ga0207652_10491076 3300025921 Unclassified 1106
52 Ga0207694_10214050 3300025924 Bacteria 1570
53 Ga0207711_11656757 3300025941 Unclassified 583
54 Ga0207661_10368914 3300025944 Bacteria 1298
55 Ga0207667_10013900 3300025949 Bacteria 9196
56 Ga0207667_10515710 3300025949 Bacteria 1211
57 Ga0207667_10524370 3300025949 Bacteria 1200
58 Ga0207667_10665289 3300025949 Bacteria 1046
59 Ga0207667_10736074 3300025949 Unclassified 986
60 Ga0207639_10151720 3300026041 Bacteria 1941
61 Ga0207702_10192294 3300026078 Bacteria 1886
62 Ga0207641_10332521 3300026088 Bacteria 1444
63 Ga0207648_11192193 3300026089 Unclassified 715
64 Ga0207676_10784024 3300026095 Unclassified 929
65 Ga0207674_10141318 3300026116 Bacteria 2367
66 Ga0265337_1004585 3300028556 Bacteria 5697
67 Ga0265337_1012487 3300028556 Bacteria 2885
68 Ga0265337_1043062 3300028556 Bacteria 1292
69 Ga0265326_10011848 3300028558 Bacteria 2566
70 Ga0265319_1039563 3300028563 Bacteria 1597
71 Ga0265319_1119041 3300028563 Bacteria 823
72 Ga0265334_10025108 3300028573 Bacteria 2414
73 Ga0265334_10096879 3300028573 Unclassified 1071
74 Ga0265323_10002522 3300028653 Bacteria 8345
75 Ga0265323_10018933 3300028653 Bacteria 2660
76 Ga0265336_10034775 3300028666 Bacteria 1556
77 Ga0265338_10000053 3300028800 Bacteria 208184
78 Ga0265338_10000160 3300028800 Bacteria 122713
79 Ga0265338_10003142 3300028800 Bacteria 23576
80 Ga0265338_10004333 3300028800 Bacteria 19241
81 Ga0265338_10010053 3300028800 Bacteria 11182
82 Ga0265338_10021300 3300028800 Bacteria 6766
83 Ga0265338_10060888 3300028800 Bacteria 3311
84 Ga0265338_10082582 3300028800 Bacteria 2690
85 Ga0265338_10190836 3300028800 Unclassified 1553
86 Ga0265338_10215130 3300028800 Bacteria 1439
87 Ga0265324_10000163 3300029957 Bacteria 51372
88 Ga0265324_10004070 3300029957 Bacteria 6716
89 Ga0265330_10055035 3300031235 Bacteria 1738
90 Ga0265320_10123807 3300031240 Unclassified 1177
91 Ga0265320_10136912 3300031240 Bacteria 1110
92 Ga0265320_10144777 3300031240 Bacteria 1075
93 Ga0265325_10009153 3300031241 Bacteria 5799
94 Ga0265325_10089120 3300031241 Bacteria 1523
95 Ga0265340_10037974 3300031247 Bacteria 2384
96 Ga0265339_10051728 3300031249 Bacteria 2240
97 Ga0265327_10002111 3300031251 Bacteria 22057
98 Ga0265316_10009868 3300031344 Bacteria 8756
99 Ga0265316_10348778 3300031344 Unclassified 1072
100 Ga0265313_10002090 3300031595 Bacteria 17844
101 Ga0307508_10458364 3300031616 Bacteria 868
102 Ga0265342_10108520 3300031712 Bacteria 1573
103 Ga0373929_0182745 3300035085 Unclassified 579
104 Ga0373944_0170668 3300035089 Unclassified 776
105 Ga0373955_0394624 3300035172 Bacteria 840
106 Ga0451807_1858778 3300041486 Unclassified 999
107 Ga0451849_1333679 3300041505 Bacteria 950
108 Ga0451577_0004486 3300042876 Bacteria 14723
109 Ga0451577_0049814 3300042876 Bacteria 3739
110 Ga0451577_0055433 3300042876 Bacteria 3537
111 Ga0453684_0004968 3300044712 Bacteria 27058
112 Ga0453684_0078134 3300044712 Bacteria 4143
113 Ga0453684_0827114 3300044712 Bacteria 997
114 Ga0451576_0131987 3300045051 Bacteria 2604
115 Ga0451576_0167994 3300045051 Bacteria 2289
116 Ga0451576_0914082 3300045051 Bacteria 921
117 Ga0495662_0173814 3300046476 Unclassified 1061
118 Ga0495662_0209365 3300046476 Bacteria 961
119 Ga0495608_0426598 3300046511 Unclassified 809
120 Ga0495628_0029344 3300046516 Bacteria 4461
121 Ga0495666_0098754 3300046526 Bacteria 1376
122 Ga0495645_0060154 3300046543 Bacteria 2754
123 Ga0495645_0696788 3300046543 Unclassified 617
124 Ga0495634_0224039 3300046642 Unclassified 1159
125 Ga0495669_0063509 3300046684 Unclassified 1675
126 Ga0495613_0091481 3300046689 Bacteria 2203
127 Ga0495613_0240936 3300046689 Bacteria 1265
128 Ga0495674_0213848 3300047319 Bacteria 1596
129 Ga0495684_0086446 3300047471 Bacteria 2377
130 Ga0495684_0258608 3300047471 Bacteria 1264
131 Ga0496114_0646771 3300048917 Unclassified 930
132 Ga0496115_0353944 3300048918 Unclassified 1197
133 Ga0496115_0434582 3300048918 Unclassified 1062
134 Ga0495601_0049365 3300053077 Bacteria 2653
135 Ga0495619_0706700 3300053085 Unclassified 685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028653 Ga0265323_10002522 Ga0265323_100025228 139
2 3300035085 Ga0373929_0182745 Ga0373929_0182745_44_475 139
3 3300025944 Ga0207661_10368914 Ga0207661_103689142 146
4 3300009174 Ga0105241_11385202 Ga0105241_113852022 158
5 iso_pu_bacteria 2786546517 2787437461 160
6 3300031251 Ga0265327_10002111 Ga0265327_1000211112 162
7 3300035089 Ga0373944_0170668 Ga0373944_0170668_16_621 162
8 3300026041 Ga0207639_10151720 Ga0207639_101517203 163
9 3300046511 Ga0495608_0426598 Ga0495608_0426598_184_696 163
10 3300046516 Ga0495628_0029344 Ga0495628_0029344_2268_2759 163
11 3300046543 Ga0495645_0060154 Ga0495645_0060154_1984_2475 163
12 3300046689 Ga0495613_0240936 Ga0495613_0240936_358_849 163
13 3300047471 Ga0495684_0086446 Ga0495684_0086446_276_767 163
14 3300053077 Ga0495601_0049365 Ga0495601_0049365_798_1289 163
15 3300053085 Ga0495619_0706700 Ga0495619_0706700_162_674 163
16 3300003320 rootH2_10316051 rootH2_103160513 164
17 3300003323 rootH1_10261486 rootH1_102614862 164
18 3300003323 rootH1_10276205 rootH1_102762051 164
19 3300005327 Ga0070658_10301342 Ga0070658_103013421 164
20 3300005330 Ga0070690_100000827 Ga0070690_10000082713 164
21 3300005330 Ga0070690_100932029 Ga0070690_1009320291 164
22 3300005339 Ga0070660_100352129 Ga0070660_1003521292 164
23 3300005340 Ga0070689_100005353 Ga0070689_1000053534 164
24 3300005340 Ga0070689_100096030 Ga0070689_1000960301 164
25 3300005341 Ga0070691_10038925 Ga0070691_100389252 164
26 3300005435 Ga0070714_100006920 Ga0070714_1000069202 164
27 3300005436 Ga0070713_100881392 Ga0070713_1008813922 164
28 3300005458 Ga0070681_10020412 Ga0070681_100204128 164
29 3300005466 Ga0070685_10275014 Ga0070685_102750142 164
30 3300005530 Ga0070679_100310114 Ga0070679_1003101141 164
31 3300005530 Ga0070679_100524790 Ga0070679_1005247902 164
32 3300005530 Ga0070679_100565281 Ga0070679_1005652812 164
33 3300005563 Ga0068855_100078028 Ga0068855_1000780284 164
34 3300005563 Ga0068855_100586518 Ga0068855_1005865182 164
35 3300005563 Ga0068855_100769814 Ga0068855_1007698142 164
36 3300005563 Ga0068855_100802726 Ga0068855_1008027262 164
37 3300005841 Ga0068863_100809224 Ga0068863_1008092242 164
38 3300005842 Ga0068858_100088497 Ga0068858_1000884973 164
39 3300006028 Ga0070717_10252270 Ga0070717_102522702 164
40 3300006237 Ga0097621_100227588 Ga0097621_1002275882 164
41 3300006237 Ga0097621_100488525 Ga0097621_1004885252 164
42 3300009093 Ga0105240_10038865 Ga0105240_100388655 164
43 3300009093 Ga0105240_10059833 Ga0105240_100598334 164
44 3300009093 Ga0105240_10183508 Ga0105240_101835081 164
45 3300009093 Ga0105240_10518167 Ga0105240_105181672 164
46 3300009174 Ga0105241_10046615 Ga0105241_100466152 164
47 3300009176 Ga0105242_11280049 Ga0105242_112800491 164
48 3300009177 Ga0105248_10854208 Ga0105248_108542081 164
49 3300009545 Ga0105237_11212135 Ga0105237_112121352 164
50 3300009551 Ga0105238_10923843 Ga0105238_109238431 164
51 3300009551 Ga0105238_11065886 Ga0105238_110658861 164
52 3300013104 Ga0157370_10046507 Ga0157370_100465072 164
53 3300013104 Ga0157370_10140210 Ga0157370_101402103 164
54 3300013296 Ga0157374_10152242 Ga0157374_101522422 164
55 3300013296 Ga0157374_11954955 Ga0157374_119549551 164
56 3300013297 Ga0157378_10034072 Ga0157378_100340724 164
57 3300013307 Ga0157372_10033868 Ga0157372_100338686 164
58 3300013307 Ga0157372_10176612 Ga0157372_101766122 164
59 3300025909 Ga0207705_10037109 Ga0207705_100371094 164
60 3300025912 Ga0207707_10084194 Ga0207707_100841941 164
61 3300025912 Ga0207707_10164198 Ga0207707_101641983 164
62 3300025913 Ga0207695_10084477 Ga0207695_100844773 164
63 3300025919 Ga0207657_10570317 Ga0207657_105703172 164
64 3300025921 Ga0207652_10162818 Ga0207652_101628182 164
65 3300025921 Ga0207652_10491076 Ga0207652_104910761 164
66 3300025924 Ga0207694_10214050 Ga0207694_102140502 164
67 3300025941 Ga0207711_11656757 Ga0207711_116567571 164
68 3300025949 Ga0207667_10013900 Ga0207667_100139009 164
69 3300025949 Ga0207667_10515710 Ga0207667_105157102 164
70 3300025949 Ga0207667_10524370 Ga0207667_105243702 164
71 3300025949 Ga0207667_10665289 Ga0207667_106652892 164
72 3300025949 Ga0207667_10736074 Ga0207667_107360742 164
73 3300026078 Ga0207702_10192294 Ga0207702_101922942 164
74 3300026088 Ga0207641_10332521 Ga0207641_103325212 164
75 3300026089 Ga0207648_11192193 Ga0207648_111921931 164
76 3300026095 Ga0207676_10784024 Ga0207676_107840242 164
77 3300026116 Ga0207674_10141318 Ga0207674_101413181 164
78 3300028556 Ga0265337_1004585 Ga0265337_10045854 164
79 3300028556 Ga0265337_1012487 Ga0265337_10124873 164
80 3300028556 Ga0265337_1043062 Ga0265337_10430622 164
81 3300028558 Ga0265326_10011848 Ga0265326_100118482 164
82 3300028563 Ga0265319_1039563 Ga0265319_10395632 164
83 3300028563 Ga0265319_1119041 Ga0265319_11190412 164
84 3300028573 Ga0265334_10025108 Ga0265334_100251083 164
85 3300028573 Ga0265334_10096879 Ga0265334_100968792 164
86 3300028653 Ga0265323_10018933 Ga0265323_100189332 164
87 3300028666 Ga0265336_10034775 Ga0265336_100347752 164
88 3300028800 Ga0265338_10000053 Ga0265338_10000053162 164
89 3300028800 Ga0265338_10000160 Ga0265338_1000016036 164
90 3300028800 Ga0265338_10003142 Ga0265338_1000314212 164
91 3300028800 Ga0265338_10004333 Ga0265338_1000433310 164
92 3300028800 Ga0265338_10010053 Ga0265338_100100535 164
93 3300028800 Ga0265338_10021300 Ga0265338_100213007 164
94 3300028800 Ga0265338_10060888 Ga0265338_100608883 164
95 3300028800 Ga0265338_10082582 Ga0265338_100825823 164
96 3300028800 Ga0265338_10190836 Ga0265338_101908363 164
97 3300028800 Ga0265338_10215130 Ga0265338_102151302 164
98 3300029957 Ga0265324_10000163 Ga0265324_1000016313 164
99 3300029957 Ga0265324_10004070 Ga0265324_100040704 164
100 3300031235 Ga0265330_10055035 Ga0265330_100550352 164
101 3300031240 Ga0265320_10123807 Ga0265320_101238071 164
102 3300031240 Ga0265320_10136912 Ga0265320_101369122 164
103 3300031240 Ga0265320_10144777 Ga0265320_101447772 164
104 3300031241 Ga0265325_10009153 Ga0265325_100091535 164
105 3300031241 Ga0265325_10089120 Ga0265325_100891202 164
106 3300031247 Ga0265340_10037974 Ga0265340_100379742 164
107 3300031249 Ga0265339_10051728 Ga0265339_100517283 164
108 3300031344 Ga0265316_10009868 Ga0265316_100098689 164
109 3300031344 Ga0265316_10348778 Ga0265316_103487782 164
110 3300031595 Ga0265313_10002090 Ga0265313_100020908 164
111 3300031616 Ga0307508_10458364 Ga0307508_104583641 164
112 3300031712 Ga0265342_10108520 Ga0265342_101085202 164
113 3300035172 Ga0373955_0394624 Ga0373955_0394624_205_708 164
114 3300041486 Ga0451807_1858778 Ga0451807_1858778_416_916 164
115 3300041505 Ga0451849_1333679 Ga0451849_1333679_121_648 164
116 3300042876 Ga0451577_0004486 Ga0451577_0004486_11406_11924 164
117 3300042876 Ga0451577_0049814 Ga0451577_0049814_3146_3658 164
118 3300042876 Ga0451577_0055433 Ga0451577_0055433_811_1317 164
119 3300044712 Ga0453684_0004968 Ga0453684_0004968_17631_18137 164
120 3300044712 Ga0453684_0078134 Ga0453684_0078134_2620_3138 164
121 3300044712 Ga0453684_0827114 Ga0453684_0827114_311_808 164
122 3300045051 Ga0451576_0131987 Ga0451576_0131987_1520_2023 164
123 3300045051 Ga0451576_0167994 Ga0451576_0167994_543_1049 164
124 3300045051 Ga0451576_0914082 Ga0451576_0914082_74_571 164
125 3300046476 Ga0495662_0173814 Ga0495662_0173814_464_967 164
126 3300046476 Ga0495662_0209365 Ga0495662_0209365_23_520 164
127 3300046526 Ga0495666_0098754 Ga0495666_0098754_59_562 164
128 3300046543 Ga0495645_0696788 Ga0495645_0696788_23_547 164
129 3300046642 Ga0495634_0224039 Ga0495634_0224039_22_525 164
130 3300046684 Ga0495669_0063509 Ga0495669_0063509_987_1487 164
131 3300046689 Ga0495613_0091481 Ga0495613_0091481_1559_2062 164
132 3300047319 Ga0495674_0213848 Ga0495674_0213848_311_820 164
133 3300047471 Ga0495684_0258608 Ga0495684_0258608_419_922 164
134 3300048917 Ga0496114_0646771 Ga0496114_0646771_179_673 164
135 3300048918 Ga0496115_0353944 Ga0496115_0353944_379_873 164
136 3300048918 Ga0496115_0434582 Ga0496115_0434582_398_940 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

45

172

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o5f-assembly2.cif.gz_B crystal structure of dr0079 from deinococcus radiodurans at 1.9 angstrom resolution 0.9011 4 163
2fkb-assembly2.cif.gz_B crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12 0.8874 2 164
2o5f-assembly2.cif.gz_B crystal structure of dr0079 from deinococcus radiodurans at 1.9 angstrom resolution 0.8853 4 163
2fkb-assembly2.cif.gz_B crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12 0.8822 2 164
2o5f-assembly1.cif.gz_A crystal structure of dr0079 from deinococcus radiodurans at 1.9 angstrom resolution 0.8656 4 163
ID Description Score Start End Superfamily
af_Q8IDK8_11_194_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8829 4 162 3.90.79.10
2fkbC00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8786 4 162 3.90.79.10
af_G5EFQ1_4_235_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8779 4 158 3.90.79.10
af_P9WKK5_11_180_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8709 4 163 3.90.79.10
2o5fA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8656 4 163 3.90.79.10
ID Description Score Start End GO Terms
AF-I0K196-F1-model_v4 Isopentenyl-diphosphate delta-isomerase 1.001 3 162 GO:0016787
GO:0016853
GO:0046872
AF-A0A2A2QN19-F1-model_v4 NUDIX hydrolase 0.9991 1 161 GO:0016787
GO:0046872
AF-A0A2D7BA81-F1-model_v4 NUDIX hydrolase 0.9991 2 162 GO:0016787
GO:0046872
AF-A0A2E5TSQ7-F1-model_v4 NUDIX hydrolase 0.9985 1 162 GO:0016787
GO:0046872
AF-A0A6I1KB24-F1-model_v4 NUDIX hydrolase 0.9971 1 163 GO:0016787
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.08 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map