F165754

General Info

Members Datasets Scaffolds Average Seq Length
136 112 272 184

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10040654|Ga0070710_100406542
Length 200
Sequence MARKRAPQPVKPAAKAPISPATAVSIWRQNRREITFLVLFLVLLGGGFALISLNWVNDHAVEPFTAGIARVSGAGLNLLGQQVSLQGTIIQSHRFAVNIRNGCNGVEAMLIFLAAVLAFPASWRSRLAGLGIGIVAIQLVNLVRVIALFLTGVYFPKLFDASHTVIWQSIVILFGVLLWILWANRWAMASAPETPVESAP

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
79 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
82 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
83 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
84 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
112 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.41
Rhizosphere 90.44
Stem 0
Stem Tuber 0
Unclassified 19.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10040654 3300005437 Bacteria 2564
2 rootL2_10051040 3300003322 Bacteria 6602
3 rootL2_10135536 3300003322 Unclassified 1387
4 rootH1_10191777 3300003323 Bacteria 3644
5 Ga0065715_10521830 3300005293 Unclassified 763
6 Ga0070658_10005320 3300005327 Bacteria 10450
7 Ga0070676_10005132 3300005328 Bacteria 6951
8 Ga0070690_100348777 3300005330 Bacteria 1074
9 Ga0068869_100004545 3300005334 Bacteria 8639
10 Ga0070666_10032605 3300005335 Unclassified 3441
11 Ga0070692_10000111 3300005345 Bacteria 18811
12 Ga0070669_100000120 3300005353 Bacteria 72772
13 Ga0070673_100875514 3300005364 Bacteria 832
14 Ga0070667_100116925 3300005367 Bacteria 2316
15 Ga0070709_10000153 3300005434 Bacteria 45500
16 Ga0070694_100000849 3300005444 Bacteria 17185
17 Ga0070708_100014509 3300005445 Bacteria 6486
18 Ga0070685_10022638 3300005466 Bacteria 3429
19 Ga0070706_100017283 3300005467 Bacteria 6658
20 Ga0070698_100003961 3300005471 Bacteria 16290
21 Ga0070698_100365820 3300005471 Bacteria 1374
22 Ga0070699_100188106 3300005518 Bacteria 1834
23 Ga0070699_100589564 3300005518 Bacteria 1013
24 Ga0070697_100050471 3300005536 Bacteria 3376
25 Ga0070697_100096859 3300005536 Unclassified 2448
26 Ga0068853_100013592 3300005539 Bacteria 6651
27 Ga0070686_100639883 3300005544 Bacteria 842
28 Ga0070696_100309683 3300005546 Unclassified 1212
29 Ga0070693_100195879 3300005547 Bacteria 1309
30 Ga0070665_100000369 3300005548 Bacteria 67135
31 Ga0070702_100350171 3300005615 Bacteria 1040
32 Ga0068852_100798014 3300005616 Unclassified 958
33 Ga0068859_100734266 3300005617 Bacteria 1077
34 Ga0068866_10172688 3300005718 Bacteria 1270
35 Ga0068861_100299495 3300005719 Unclassified 1392
36 Ga0068858_100099046 3300005842 Unclassified 2718
37 Ga0068860_100000522 3300005843 Bacteria 46972
38 Ga0068862_100000997 3300005844 Bacteria 27086
39 Ga0068862_100392371 3300005844 Bacteria 1297
40 Ga0070717_10670289 3300006028 Unclassified 942
41 Ga0070715_10487462 3300006163 Bacteria 703
42 Ga0070716_100057967 3300006173 Bacteria 2227
43 Ga0070716_100063317 3300006173 Unclassified 2147
44 Ga0075431_100002068 3300006847 Bacteria 19166
45 Ga0075433_10083605 3300006852 Bacteria 2817
46 Ga0075434_100016402 3300006871 Bacteria 7121
47 Ga0075434_100020045 3300006871 Bacteria 6479
48 Ga0075434_100348484 3300006871 Unclassified 1502
49 Ga0075434_100397467 3300006871 Bacteria 1399
50 Ga0075434_100426345 3300006871 Bacteria 1348
51 Ga0068865_100338530 3300006881 Bacteria 1215
52 Ga0075436_100000509 3300006914 Bacteria 25152
53 Ga0097620_100734341 3300006931 Bacteria 1077
54 Ga0075435_100185677 3300007076 Bacteria 1758
55 Ga0075435_100751040 3300007076 Bacteria 849
56 Ga0111539_10419899 3300009094 Bacteria 1558
57 Ga0111539_10827258 3300009094 Bacteria 1077
58 Ga0105245_10762561 3300009098 Bacteria 1004
59 Ga0114129_10111539 3300009147 Bacteria 3774
60 Ga0105249_10022188 3300009553 Bacteria 5686
61 Ga0105249_10301279 3300009553 Bacteria 1608
62 Ga0105249_11295300 3300009553 Unclassified 800
63 Ga0157378_10253130 3300013297 Unclassified 1687
64 Ga0163162_10050597 3300013306 Unclassified 4166
65 Ga0157372_10617483 3300013307 Bacteria 1263
66 Ga0157380_10093765 3300014326 Bacteria 2483
67 Ga0157379_10034304 3300014968 Bacteria 4524
68 Ga0207692_10015718 3300025898 Bacteria 3338
69 Ga0207680_10624109 3300025903 Bacteria 771
70 Ga0207699_10000067 3300025906 Bacteria 82866
71 Ga0207645_10008493 3300025907 Bacteria 7161
72 Ga0207684_10001273 3300025910 Bacteria 27823
73 Ga0207684_10039840 3300025910 Bacteria 3983
74 Ga0207681_10000101 3300025923 Bacteria 72788
75 Ga0207681_10045489 3300025923 Bacteria 2948
76 Ga0207687_10449730 3300025927 Bacteria 1068
77 Ga0207700_10202133 3300025928 Bacteria 1675
78 Ga0207670_10004419 3300025936 Bacteria 7569
79 Ga0207704_10558450 3300025938 Unclassified 931
80 Ga0207665_10090019 3300025939 Bacteria 2126
81 Ga0207691_10006355 3300025940 Bacteria 11414
82 Ga0207689_10015008 3300025942 Bacteria 6570
83 Ga0207712_10184700 3300025961 Unclassified 1641
84 Ga0207658_10035960 3300025986 Bacteria 3550
85 Ga0207703_10424583 3300026035 Bacteria 1238
86 Ga0207678_10835747 3300026067 Bacteria 813
87 Ga0207641_10139594 3300026088 Bacteria 2185
88 Ga0207675_100024380 3300026118 Bacteria 5626
89 Ga0207675_100143180 3300026118 Bacteria 2272
90 Ga0209974_10019741 3300027876 Bacteria 2235
91 Ga0268266_10001946 3300028379 Bacteria 23214
92 Ga0268265_10000712 3300028380 Bacteria 32721
93 Ga0268265_10004135 3300028380 Bacteria 10188
94 Ga0268264_10004845 3300028381 Bacteria 11403
95 Ga0268264_10057754 3300028381 Unclassified 3246
96 Ga0307508_10173983 3300031616 Unclassified 1756
97 Ga0373929_0000001 3300035085 Bacteria 956023
98 Ga0373961_0001262 3300035241 Bacteria 7737
99 Ga0373935_0004998 3300035692 Bacteria 7805
100 Ga0451807_0434801 3300041486 Bacteria 4308
101 Ga0451833_1286639 3300041491 Unclassified 1123
102 Ga0451849_1036827 3300041505 Unclassified 1750
103 Ga0451855_1446681 3300041511 Unclassified 750
104 Ga0451577_0037061 3300042876 Bacteria 4391
105 Ga0451577_0074111 3300042876 Unclassified 3037
106 Ga0453683_0572135 3300044673 Bacteria 736
107 Ga0466963_0178074 3300044694 Unclassified 1484
108 Ga0453684_0407028 3300044712 Unclassified 1522
109 Ga0451576_0261678 3300045051 Unclassified 1808
110 Ga0495580_0000236 3300046472 Bacteria 43583
111 Ga0496102_0017410 3300048905 Bacteria 6296
112 Ga0496102_0544827 3300048905 Bacteria 1083
113 Ga0496106_0065779 3300048909 Bacteria 2760
114 Ga0496111_0114293 3300048914 Viruses 1990
115 Ga0496114_0001476 3300048917 Bacteria 17853
116 Ga0501033_0754094 3300049570 Bacteria 660
117 Ga0501034_0870318 3300049571 Bacteria 790
118 Ga0501067_0006035 3300049583 Bacteria 6715
119 Ga0501068_0096967 3300049584 Bacteria 1824
120 Ga0501073_0418440 3300049589 Unclassified 926
121 Ga0501075_0003473 3300049591 Bacteria 10543
122 Ga0501077_0032262 3300049593 Bacteria 3334
123 Ga0501080_0144581 3300049742 Bacteria 2198
124 Ga0501083_0000985 3300049744 Bacteria 18902
125 nmdc:mga05p37_89806_c1 3300050507 Bacteria 3786
126 nmdc:mga06r32_11294_c1 3300050510 Bacteria 8044
127 nmdc:mga08y16_1133642_c1 3300050511 Unclassified 756
128 nmdc:mga08y16_631720_c1 3300050511 Bacteria 1077
129 nmdc:mga0n895_122361_c1 3300050512 Bacteria 2624
130 nmdc:mga0n895_18242_c1 3300050512 Bacteria 6488
131 nmdc:mga0rr50_520307_c1 3300050513 Bacteria 1012
132 nmdc:mga0rr50_55182_c1 3300050513 Bacteria 2963
133 nmdc:mga08x19_114_c1 3300050514 Bacteria 71338
134 nmdc:mga0a205_102769_c1 3300050515 Bacteria 1461
135 Ga0501082_0000064 3300060353 Bacteria 76684
136 Ga0530510_0046834 3300061734 Bacteria 3124
137 Ga0070710_10040654
138 rootL2_10051040
139 rootL2_10135536
140 rootH1_10191777
141 Ga0065715_10521830
142 Ga0070658_10005320
143 Ga0070676_10005132
144 Ga0070690_100348777
145 Ga0068869_100004545
146 Ga0070666_10032605
147 Ga0070692_10000111
148 Ga0070669_100000120
149 Ga0070673_100875514
150 Ga0070667_100116925
151 Ga0070709_10000153
152 Ga0070694_100000849
153 Ga0070708_100014509
154 Ga0070685_10022638
155 Ga0070706_100017283
156 Ga0070698_100003961
157 Ga0070698_100365820
158 Ga0070699_100188106
159 Ga0070699_100589564
160 Ga0070697_100050471
161 Ga0070697_100096859
162 Ga0068853_100013592
163 Ga0070686_100639883
164 Ga0070696_100309683
165 Ga0070693_100195879
166 Ga0070665_100000369
167 Ga0070702_100350171
168 Ga0068852_100798014
169 Ga0068859_100734266
170 Ga0068866_10172688
171 Ga0068861_100299495
172 Ga0068858_100099046
173 Ga0068860_100000522
174 Ga0068862_100000997
175 Ga0068862_100392371
176 Ga0070717_10670289
177 Ga0070715_10487462
178 Ga0070716_100057967
179 Ga0070716_100063317
180 Ga0075431_100002068
181 Ga0075433_10083605
182 Ga0075434_100016402
183 Ga0075434_100020045
184 Ga0075434_100348484
185 Ga0075434_100397467
186 Ga0075434_100426345
187 Ga0068865_100338530
188 Ga0075436_100000509
189 Ga0097620_100734341
190 Ga0075435_100185677
191 Ga0075435_100751040
192 Ga0111539_10419899
193 Ga0111539_10827258
194 Ga0105245_10762561
195 Ga0114129_10111539
196 Ga0105249_10022188
197 Ga0105249_10301279
198 Ga0105249_11295300
199 Ga0157378_10253130
200 Ga0163162_10050597
201 Ga0157372_10617483
202 Ga0157380_10093765
203 Ga0157379_10034304
204 Ga0207692_10015718
205 Ga0207680_10624109
206 Ga0207699_10000067
207 Ga0207645_10008493
208 Ga0207684_10001273
209 Ga0207684_10039840
210 Ga0207681_10000101
211 Ga0207681_10045489
212 Ga0207687_10449730
213 Ga0207700_10202133
214 Ga0207670_10004419
215 Ga0207704_10558450
216 Ga0207665_10090019
217 Ga0207691_10006355
218 Ga0207689_10015008
219 Ga0207712_10184700
220 Ga0207658_10035960
221 Ga0207703_10424583
222 Ga0207678_10835747
223 Ga0207641_10139594
224 Ga0207675_100024380
225 Ga0207675_100143180
226 Ga0209974_10019741
227 Ga0268266_10001946
228 Ga0268265_10000712
229 Ga0268265_10004135
230 Ga0268264_10004845
231 Ga0268264_10057754
232 Ga0307508_10173983
233 Ga0373929_0000001
234 Ga0373961_0001262
235 Ga0373935_0004998
236 Ga0451807_0434801
237 Ga0451833_1286639
238 Ga0451849_1036827
239 Ga0451855_1446681
240 Ga0451577_0037061
241 Ga0451577_0074111
242 Ga0453683_0572135
243 Ga0466963_0178074
244 Ga0453684_0407028
245 Ga0451576_0261678
246 Ga0495580_0000236
247 Ga0496102_0017410
248 Ga0496102_0544827
249 Ga0496106_0065779
250 Ga0496111_0114293
251 Ga0496114_0001476
252 Ga0501033_0754094
253 Ga0501034_0870318
254 Ga0501067_0006035
255 Ga0501068_0096967
256 Ga0501073_0418440
257 Ga0501075_0003473
258 Ga0501077_0032262
259 Ga0501080_0144581
260 Ga0501083_0000985
261 nmdc:mga05p37_89806_c1
262 nmdc:mga06r32_11294_c1
263 nmdc:mga08y16_1133642_c1
264 nmdc:mga08y16_631720_c1
265 nmdc:mga0n895_122361_c1
266 nmdc:mga0n895_18242_c1
267 nmdc:mga0rr50_520307_c1
268 nmdc:mga0rr50_55182_c1
269 nmdc:mga08x19_114_c1
270 nmdc:mga0a205_102769_c1
271 Ga0501082_0000064
272 Ga0530510_0046834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09721

Exosortase_EpsH

Transmembrane exosortase (Exosortase_EpsH)

23

188

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ddz-assembly1.cif.gz_F protein of unknown function from pyrococcus horikoshi 0.8731 53 90
4brb-assembly2.cif.gz_D crystal structure of the integral membrane enzyme dgka-ref, delta 7 0.5079 98 178
4brb-assembly2.cif.gz_D crystal structure of the integral membrane enzyme dgka-ref, delta 7 0.4136 98 178
5f3w-assembly1.cif.gz_D structure of the atprs-mre11/rad50-dna complex 0.3433 22 111
2id6-assembly1.cif.gz_A-2 crystal structure of transcriptional regulator (tm1030) at 1.75a resolution 0.3331 22 177
ID Description Score Start End Superfamily
2ddzF00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8731 53 90 3.30.930.10
af_Q58215_29_219_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8265 54 90 3.30.930.10
4uxzD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5205 98 177 1.10.287.3610
4uxwC00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5196 98 177 1.10.287.3610
4brbD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5079 98 178 1.10.287.3610
ID Description Score Start End GO Terms
AF-A0A2V7W2V2-F1-model_v4 Exosortase H 0.9837 24 180 GO:0005886
GO:0006508
GO:0008233
AF-A0A1F4X8R2-F1-model_v4 Exosortase H 0.9712 19 179 GO:0005886
GO:0006508
GO:0008233
AF-A0A2V7XVM6-F1-model_v4 Exosortase H 0.9702 26 180 GO:0005886
GO:0006508
GO:0008233
AF-A0A432SM57-F1-model_v4 Exosortase H 0.9656 23 179 GO:0005886
GO:0006508
GO:0008233
AF-A0A3N5JJ03-F1-model_v4 Exosortase H (EC 3.4.22.-) 0.9643 27 179 GO:0005886
GO:0006508
GO:0008233

Map