F165260

General Info

Members Datasets Scaffolds Average Seq Length
136 103 272 169

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10209798|Ga0065714_102097982
Length 192
Sequence MVRRLPAEPLDPGAFIATLKPMTTLVLTVVGADRAGLVAAVADVVDAHGGNWENSQLAELSGAFAGIIEVSVDTGRVDELRTALSKLDGLLTVAVHESEAAAAEAAEPRRFAFRVLGNDHPGIVREISSTLSAHGLSIDRMSSETYDAAMSGGRLFEALIAVRVEDAVDVDAVTSALEALAAEIQVDVTLES

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
6 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
7 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
8 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
9 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
10 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
11 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
12 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
13 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
14 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
15 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
16 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
18 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
19 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
20 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
21 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
22 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
23 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
24 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
25 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
26 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
27 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
28 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
29 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
30 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
31 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
32 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
33 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
34 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
35 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
36 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
37 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
38 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
39 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
40 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
41 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
42 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
43 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
44 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
45 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
46 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
47 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
48 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
49 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
50 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
51 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
52 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
53 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
54 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
55 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
56 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
57 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
58 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
59 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
63 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
64 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
65 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
66 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
67 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
68 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
69 2643221553 Microbacterium sp. Root553 Isolate Unclassified
70 2643221566 Microbacterium sp. Root166 Isolate Unclassified
71 2643221575 Microbacterium sp. Root61 Isolate Unclassified
72 2643221597 Microbacterium sp. Root180 Isolate Unclassified
73 2643221630 Microbacterium sp. Root322 Isolate Unclassified
74 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
75 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
76 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
77 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
78 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
79 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
80 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
81 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
82 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
83 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
84 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
85 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
86 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
87 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
88 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
89 2919069694 Microbacterium sp. 1154 Isolate Unclassified
90 2919395869 Microbacterium resistens 2980 Isolate Unclassified
91 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
92 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
93 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
94 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
95 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
96 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
97 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
98 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
99 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
100 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
101 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
102 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
103 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 72.79
Metatranscriptomes 0
Isolates 27.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.74
Bulb 0
Endosphere 8.09
Nodule 0
Rhizoplane 12.5
Rhizosphere 36.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10209798 3300005288 Bacteria 870
2 JGI24740J21852_10002954 3300001979 Bacteria 7553
3 JGI25154J39366_1001157 3300002738 Bacteria 10179
4 rootH2_10034915 3300003320 Bacteria 1184
5 Ga0075365_10077621 3300006038 Bacteria 2244
6 Ga0075363_100000614 3300006048 Bacteria 11775
7 Ga0075364_10023066 3300006051 Bacteria 3938
8 Ga0075364_10025078 3300006051 Bacteria 3793
9 Ga0075364_10169264 3300006051 Bacteria 1476
10 Ga0075367_10001372 3300006178 Bacteria 10389
11 Ga0075370_10012962 3300006353 Bacteria 4421
12 Ga0157370_10331033 3300013104 Bacteria 1404
13 Ga0157369_11390429 3300013105 Bacteria 714
14 Ga0171462_1005 3300013250 Bacteria 598379
15 Ga0157380_10095584 3300014326 Bacteria 2462
16 Ga0163161_10394445 3300017792 Bacteria 1109
17 Ga0209646_1000014 3300025246 Bacteria 550484
18 Ga0268266_10106835 3300028379 Bacteria 2475
19 Ga0307405_10763868 3300031731 Bacteria 806
20 Ga0307413_10288128 3300031824 Bacteria 1239
21 Ga0307406_10000637 3300031901 Bacteria 19993
22 Ga0307406_10145623 3300031901 Bacteria 1683
23 Ga0307406_10764278 3300031901 Bacteria 812
24 Ga0307409_101082330 3300031995 Bacteria 822
25 Ga0307416_100126279 3300032002 Bacteria 2292
26 Ga0307414_10759419 3300032004 Bacteria 882
27 Ga0307414_10817126 3300032004 Bacteria 851
28 Ga0307415_100237883 3300032126 Bacteria 1471
29 Ga0395898_0088149 3300037466 Bacteria 2988
30 Ga0439465_0144047 3300041413 Bacteria 848
31 Ga0451789_1224823 3300041443 Bacteria 566
32 Ga0451793_1066596 3300041452 Bacteria 781
33 Ga0451835_1143263 3300041492 Bacteria 951
34 Ga0451841_0311617 3300041498 Bacteria 1317
35 Ga0451841_1035006 3300041498 Bacteria 742
36 Ga0451845_0171475 3300041501 Bacteria 647
37 Ga0451843_0294932 3300041509 Bacteria 584
38 Ga0451853_2715957 3300041512 Bacteria 1107
39 Ga0451853_3865274 3300041512 Bacteria 1567
40 Ga0466972_0022603 3300044658 Bacteria 3130
41 Ga0466965_0090993 3300044683 Bacteria 1552
42 Ga0466968_0023511 3300044735 Bacteria 2512
43 Ga0466970_0000393 3300044765 Bacteria 21236
44 Ga0466970_0057741 3300044765 Bacteria 2076
45 Ga0466970_0377499 3300044765 Bacteria 807
46 Ga0466960_0128670 3300044901 Bacteria 1334
47 Ga0466958_0127349 3300045836 Bacteria 1597
48 Ga0495627_000783 3300046453 Bacteria 23455
49 Ga0495656_0398494 3300046615 Bacteria 720
50 Ga0495625_0174950 3300046660 Bacteria 1431
51 Ga0496104_0198837 3300048907 Bacteria 1916
52 Ga0496104_0999137 3300048907 Bacteria 741
53 Ga0496105_0174730 3300048908 Bacteria 1760
54 Ga0496105_0220649 3300048908 Bacteria 1543
55 Ga0496105_0413809 3300048908 Bacteria 1068
56 Ga0496108_0533462 3300048911 Bacteria 1024
57 Ga0496109_0042071 3300048912 Bacteria 4138
58 Ga0496109_1500421 3300048912 Bacteria 609
59 Ga0496110_0583757 3300048913 Bacteria 1014
60 Ga0496111_0614524 3300048914 Bacteria 795
61 Ga0496113_0816885 3300048916 Bacteria 740
62 Ga0496114_0012890 3300048917 Bacteria 6697
63 Ga0496114_0184853 3300048917 Bacteria 1821
64 Ga0496114_0352016 3300048917 Bacteria 1303
65 Ga0496114_0755256 3300048917 Bacteria 850
66 Ga0496117_0003249 3300048920 Bacteria 19130
67 Ga0496117_0212669 3300048920 Bacteria 1083
68 Ga0496118_0026164 3300048921 Bacteria 4977
69 Ga0496119_0002020 3300048922 Bacteria 22984
70 Ga0496119_0007771 3300048922 Bacteria 9561
71 Ga0496119_0028853 3300048922 Bacteria 3777
72 Ga0496120_0002501 3300048923 Bacteria 18438
73 Ga0496122_0007359 3300048925 Bacteria 12268
74 Ga0496122_0012542 3300048925 Bacteria 8419
75 Ga0496122_0035313 3300048925 Bacteria 4070
76 Ga0496122_0045947 3300048925 Bacteria 3387
77 Ga0496123_0002368 3300048926 Bacteria 23643
78 Ga0496123_0075997 3300048926 Bacteria 2070
79 Ga0496124_0009338 3300048927 Bacteria 10104
80 Ga0496124_0142915 3300048927 Bacteria 1886
81 Ga0496124_0162406 3300048927 Bacteria 1740
82 Ga0496125_0002390 3300048928 Bacteria 24451
83 Ga0496125_0004593 3300048928 Bacteria 15782
84 Ga0496125_0042210 3300048928 Bacteria 3888
85 Ga0496125_0102464 3300048928 Bacteria 2103
86 Ga0496125_0143891 3300048928 Bacteria 1652
87 Ga0496126_0004574 3300048929 Bacteria 16419
88 Ga0496126_0353517 3300048929 Bacteria 1201
89 Ga0496126_0664960 3300048929 Bacteria 813
90 Ga0501034_0001600 3300049571 Bacteria 29443
91 Ga0501034_0029536 3300049571 Bacteria 5573
92 Ga0501034_1060649 3300049571 Bacteria 692
93 Ga0501036_0400700 3300049572 Bacteria 1145
94 Ga0501037_0876941 3300049573 Bacteria 589
95 Ga0501038_0251102 3300049574 Bacteria 1401
96 nmdc:mga00v17_22937_c1 3300050491 Bacteria 3607
97 nmdc:mga0yw44_7586_c1 3300050492 Bacteria 5348
98 nmdc:mga06z11_1049_c2 3300050494 Bacteria 3872
99 nmdc:mga07m45_31610_c1 3300050496 Bacteria 2934
100 2588108240 2585428157 Bacteria 3018951
101 2643732881 2643221542 Bacteria 3563959
102 2643784785 2643221553 Bacteria 3544260
103 2643847530 2643221566 Bacteria 3460379
104 2643887308 2643221575 Bacteria 4022601
105 2643997555 2643221597 Bacteria 3347721
106 2644171671 2643221630 Bacteria 3601215
107 2644681562 2643221724 Bacteria 3593515
108 2730231034 2728369380 Bacteria 3620317
109 2747954127 2747842429 Bacteria 3914386
110 2758227275 2757320536 Bacteria 3629334
111 2774381679 2773857758 Bacteria 3592392
112 2809228128 2808606447 Bacteria 3572005
113 2812324198 2811994872 Bacteria 4121241
114 2821268571 2821268502 Bacteria 3750023
115 2833713233 2833709550 Bacteria 4008291
116 2852634836 2852632344 Bacteria 3463163
117 2852647890 2852646457 Bacteria 3408613
118 2852663736 2852663356 Bacteria 4090475
119 2857726368 2857723135 Bacteria 4217853
120 2904512665 2904509784 Bacteria 3520416
121 2908681337 2908678064 Bacteria 3482747
122 2919071501 2919069694 Bacteria 3622919
123 2919397322 2919395869 Bacteria 3704152
124 2945969159 2945968032 Bacteria 4111363
125 2946036055 2946033335 Bacteria 3835514
126 2946045608 2946041624 Bacteria 4191385
127 2946083685 2946080515 Bacteria 4310960
128 2974297683 2974294766 Bacteria 3767688
129 2974326082 2974324384 Bacteria 3750535
130 2977231045 2977228692 Bacteria 3450105
131 2977239839 2977236895 Bacteria 3569373
132 2977266282 2977264416 Bacteria 3750737
133 2984545888 2984542743 Bacteria 3569378
134 8004184141 8004182704 Bacteria 3391155
135 8016257854 8016254467 Bacteria 3797036
136 8045831104 8045830549 Bacteria 4444727
137 Ga0065714_10209798
138 JGI24740J21852_10002954
139 JGI25154J39366_1001157
140 rootH2_10034915
141 Ga0075365_10077621
142 Ga0075363_100000614
143 Ga0075364_10023066
144 Ga0075364_10025078
145 Ga0075364_10169264
146 Ga0075367_10001372
147 Ga0075370_10012962
148 Ga0157370_10331033
149 Ga0157369_11390429
150 Ga0171462_1005
151 Ga0157380_10095584
152 Ga0163161_10394445
153 Ga0209646_1000014
154 Ga0268266_10106835
155 Ga0307405_10763868
156 Ga0307413_10288128
157 Ga0307406_10000637
158 Ga0307406_10145623
159 Ga0307406_10764278
160 Ga0307409_101082330
161 Ga0307416_100126279
162 Ga0307414_10759419
163 Ga0307414_10817126
164 Ga0307415_100237883
165 Ga0395898_0088149
166 Ga0439465_0144047
167 Ga0451789_1224823
168 Ga0451793_1066596
169 Ga0451835_1143263
170 Ga0451841_0311617
171 Ga0451841_1035006
172 Ga0451845_0171475
173 Ga0451843_0294932
174 Ga0451853_2715957
175 Ga0451853_3865274
176 Ga0466972_0022603
177 Ga0466965_0090993
178 Ga0466968_0023511
179 Ga0466970_0000393
180 Ga0466970_0057741
181 Ga0466970_0377499
182 Ga0466960_0128670
183 Ga0466958_0127349
184 Ga0495627_000783
185 Ga0495656_0398494
186 Ga0495625_0174950
187 Ga0496104_0198837
188 Ga0496104_0999137
189 Ga0496105_0174730
190 Ga0496105_0220649
191 Ga0496105_0413809
192 Ga0496108_0533462
193 Ga0496109_0042071
194 Ga0496109_1500421
195 Ga0496110_0583757
196 Ga0496111_0614524
197 Ga0496113_0816885
198 Ga0496114_0012890
199 Ga0496114_0184853
200 Ga0496114_0352016
201 Ga0496114_0755256
202 Ga0496117_0003249
203 Ga0496117_0212669
204 Ga0496118_0026164
205 Ga0496119_0002020
206 Ga0496119_0007771
207 Ga0496119_0028853
208 Ga0496120_0002501
209 Ga0496122_0007359
210 Ga0496122_0012542
211 Ga0496122_0035313
212 Ga0496122_0045947
213 Ga0496123_0002368
214 Ga0496123_0075997
215 Ga0496124_0009338
216 Ga0496124_0142915
217 Ga0496124_0162406
218 Ga0496125_0002390
219 Ga0496125_0004593
220 Ga0496125_0042210
221 Ga0496125_0102464
222 Ga0496125_0143891
223 Ga0496126_0004574
224 Ga0496126_0353517
225 Ga0496126_0664960
226 Ga0501034_0001600
227 Ga0501034_0029536
228 Ga0501034_1060649
229 Ga0501036_0400700
230 Ga0501037_0876941
231 Ga0501038_0251102
232 nmdc:mga00v17_22937_c1
233 nmdc:mga0yw44_7586_c1
234 nmdc:mga06z11_1049_c2
235 nmdc:mga07m45_31610_c1
236 2588108240
237 2643732881
238 2643784785
239 2643847530
240 2643887308
241 2643997555
242 2644171671
243 2644681562
244 2730231034
245 2747954127
246 2758227275
247 2774381679
248 2809228128
249 2812324198
250 2821268571
251 2833713233
252 2852634836
253 2852647890
254 2852663736
255 2857726368
256 2904512665
257 2908681337
258 2919071501
259 2919397322
260 2945969159
261 2946036055
262 2946045608
263 2946083685
264 2974297683
265 2974326082
266 2977231045
267 2977239839
268 2977266282
269 2984545888
270 8004184141
271 8016257854
272 8045831104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01842

ACT

ACT domain

112

182

0.94

PF13740

ACT_6

ACT domain

23

96

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n0v-assembly1.cif.gz_B crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.8732 87 168
1zpv-assembly1.cif.gz_C act domain protein from streptococcus pneumoniae 0.872 86 169
3lou-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.8718 88 169
3n0v-assembly1.cif.gz_C crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.8708 87 168
3w7b-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase from thermus thermophilus hb8 0.847 88 169
ID Description Score Start End Superfamily
1u8sA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9109 88 169 3.30.70.260
af_P0A9I3_92_188_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9062 88 169 3.30.70.260
2nyiB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9008 87 168 3.30.70.260
af_Q58953_1_90_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8991 88 169 3.30.70.260
1zpvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.862 87 169 3.30.70.260
ID Description Score Start End GO Terms
AF-S7V4X4-F1-model_v4 ACT domain-containing protein 0.97 92 167
AF-A0A832GD17-F1-model_v4 ACT domain-containing protein 0.9525 90 167
AF-A0A2R7M5J5-F1-model_v4 Amino acid-binding ACT protein 0.9468 1 79
AF-A0A536TH25-F1-model_v4 Formyl transferase 0.943 2 78 GO:0016740
AF-A0A2R7M5J5-F1-model_v4 Amino acid-binding ACT protein 0.9355 1 79

Map