F165145

General Info

Members Datasets Scaffolds Average Seq Length
136 99 272 148

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10002322|JGI25406J46586_100023222
Length 162
Sequence MAGKSILLVEDNRTEEALMLYALSKSEATSKIVIARDGAEALQFLFNMSASSEYSTNQPSMVLLDLNLPKIGGLEVLRRIRSHGGTRMIPVIILSSSDLEADVRSSYLLGANSYIKKQTNFEQFSQTVKQLVSYWLGINQLPPISIADPKPAGYAQASAAIR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
36 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
37 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
38 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
39 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
42 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
43 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
44 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
60 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
61 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
62 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
66 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
67 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
70 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
71 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
72 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
73 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
74 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
88 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
92 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
93 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
94 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
95 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
96 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
97 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
98 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.41
Nodule 0
Rhizoplane 2.21
Rhizosphere 89.71
Stem 0
Stem Tuber 0
Unclassified 21.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002322 3300003203 Bacteria 8984
2 Ga0065714_10070250 3300005288 Unclassified 3911
3 Ga0070658_10598890 3300005327 Unclassified 955
4 Ga0070683_100039960 3300005329 Bacteria 4310
5 Ga0070667_101830243 3300005367 Bacteria 571
6 Ga0070711_100045151 3300005439 Bacteria 2995
7 Ga0070705_100000064 3300005440 Bacteria 55926
8 Ga0070700_101078123 3300005441 Unclassified 665
9 Ga0070686_100983578 3300005544 Unclassified 691
10 Ga0068855_100017709 3300005563 Bacteria 8566
11 Ga0068855_100229448 3300005563 Bacteria 2080
12 Ga0068855_100674146 3300005563 Bacteria 1108
13 Ga0068857_100890862 3300005577 Bacteria 853
14 Ga0068857_101198043 3300005577 Unclassified 735
15 Ga0068854_101884553 3300005578 Unclassified 549
16 Ga0068856_100000160 3300005614 Bacteria 69926
17 Ga0068856_100003820 3300005614 Bacteria 15100
18 Ga0068856_100040298 3300005614 Bacteria 4587
19 Ga0068859_100634089 3300005617 Unclassified 1161
20 Ga0068859_101012921 3300005617 Unclassified 912
21 Ga0068863_101335449 3300005841 Bacteria 724
22 Ga0068860_100608711 3300005843 Bacteria 1098
23 Ga0081539_10003514 3300005985 Bacteria 19110
24 Ga0070712_100516110 3300006175 Unclassified 1003
25 Ga0075366_10063151 3300006195 Bacteria 2201
26 Ga0075433_10119132 3300006852 Bacteria 2343
27 Ga0075433_10427535 3300006852 Unclassified 1168
28 Ga0097620_100634094 3300006931 Unclassified 1161
29 Ga0097620_101012632 3300006931 Unclassified 912
30 Ga0105240_10311663 3300009093 Bacteria 1797
31 Ga0105243_11139333 3300009148 Unclassified 790
32 Ga0105248_11939067 3300009177 Bacteria 669
33 Ga0105238_10017221 3300009551 Bacteria 7341
34 Ga0105238_10203558 3300009551 Bacteria 1955
35 Ga0105238_10442619 3300009551 Unclassified 1296
36 Ga0157370_11615503 3300013104 Unclassified 582
37 Ga0157379_11092893 3300014968 Unclassified 763
38 Ga0207643_10273942 3300025908 Unclassified 1045
39 Ga0207705_10289002 3300025909 Bacteria 1256
40 Ga0207693_10447824 3300025915 Unclassified 1009
41 Ga0207694_10080955 3300025924 Bacteria 2550
42 Ga0207694_10137978 3300025924 Bacteria 1960
43 Ga0207694_10226262 3300025924 Unclassified 1527
44 Ga0207667_10040159 3300025949 Bacteria 4982
45 Ga0207702_10000452 3300026078 Bacteria 46403
46 Ga0207702_10000885 3300026078 Bacteria 31187
47 Ga0207702_10051503 3300026078 Bacteria 3480
48 Ga0207702_10727598 3300026078 Bacteria 979
49 Ga0207674_10208485 3300026116 Bacteria 1904
50 Ga0207674_10997107 3300026116 Unclassified 807
51 Ga0265337_1002484 3300028556 Bacteria 8413
52 Ga0265337_1044429 3300028556 Bacteria 1268
53 Ga0265319_1000827 3300028563 Bacteria 19683
54 Ga0265318_10069947 3300028577 Bacteria 1301
55 Ga0265322_10117653 3300028654 Bacteria 757
56 Ga0307515_10097756 3300028794 Bacteria 3584
57 Ga0265338_10298431 3300028800 Bacteria 1172
58 Ga0265338_10314924 3300028800 Bacteria 1134
59 Ga0265324_10011311 3300029957 Bacteria 3404
60 Ga0265330_10005481 3300031235 Bacteria 6331
61 Ga0265332_10000277 3300031238 Bacteria 40377
62 Ga0265328_10169056 3300031239 Bacteria 825
63 Ga0265320_10000819 3300031240 Bacteria 23457
64 Ga0265320_10004019 3300031240 Bacteria 9673
65 Ga0265320_10060427 3300031240 Bacteria 1809
66 Ga0265320_10264914 3300031240 Unclassified 761
67 Ga0265329_10005308 3300031242 Bacteria 5223
68 Ga0265339_10082131 3300031249 Bacteria 1702
69 Ga0265331_10000052 3300031250 Bacteria 180662
70 Ga0265327_10005731 3300031251 Bacteria 10236
71 Ga0265327_10226672 3300031251 Bacteria 839
72 Ga0265316_10000027 3300031344 Bacteria 164765
73 Ga0265316_11107194 3300031344 Bacteria 549
74 Ga0307513_10249235 3300031456 Bacteria 1574
75 Ga0307508_10000266 3300031616 Bacteria 63937
76 Ga0265314_10000122 3300031711 Bacteria 120095
77 Ga0265314_10036508 3300031711 Bacteria 3571
78 Ga0265314_10049202 3300031711 Bacteria 2953
79 Ga0265342_10010690 3300031712 Bacteria 6341
80 Ga0307516_10000379 3300031730 Bacteria 58257
81 Ga0307405_11124899 3300031731 Bacteria 676
82 Ga0373924_0011459 3300035410 Bacteria 3293
83 Ga0373927_0027869 3300035695 Bacteria 3688
84 Ga0451787_322436 3300041441 Bacteria 1413
85 Ga0451793_0495206 3300041452 Bacteria 2913
86 Ga0451800_0780729 3300041459 Bacteria 1461
87 Ga0451841_0196224 3300041498 Bacteria 1843
88 Ga0453684_0008321 3300044712 Bacteria 18665
89 Ga0453684_0360523 3300044712 Bacteria 1637
90 Ga0453684_1553224 3300044712 Bacteria 681
91 Ga0451576_0002847 3300045051 Bacteria 24868
92 Ga0495580_0760734 3300046472 Unclassified 630
93 Ga0495596_0056181 3300046500 Bacteria 1538
94 Ga0495632_0376330 3300046519 Bacteria 622
95 Ga0495643_0001581 3300046522 Bacteria 20221
96 Ga0495674_0493646 3300047319 Bacteria 980
97 Ga0495674_1098014 3300047319 Unclassified 606
98 Ga0495680_0604185 3300047322 Bacteria 734
99 Ga0501291_030966 3300049514 Bacteria 902
100 Ga0501292_003399 3300049515 Bacteria 2125
101 Ga0501300_029542 3300049523 Unclassified 807
102 Ga0501031_0000004 3300049568 Bacteria 202781
103 Ga0501032_0010346 3300049569 Bacteria 6725
104 Ga0501032_0010479 3300049569 Bacteria 6685
105 Ga0501033_0000212 3300049570 Bacteria 55695
106 Ga0501034_0752196 3300049571 Bacteria 870
107 Ga0501036_0363915 3300049572 Unclassified 1207
108 Ga0501036_0704447 3300049572 Unclassified 834
109 Ga0501038_0310479 3300049574 Bacteria 1236
110 Ga0501038_0437626 3300049574 Bacteria 1007
111 Ga0501039_0145160 3300049575 Bacteria 1865
112 Ga0501041_0084452 3300049577 Bacteria 1957
113 Ga0501043_0154478 3300049579 Unclassified 1795
114 Ga0501046_0000465 3300049580 Bacteria 40544
115 Ga0501046_0009310 3300049580 Bacteria 8500
116 Ga0501046_0559797 3300049580 Bacteria 814
117 Ga0501047_0001911 3300049581 Bacteria 20028
118 Ga0501047_0131730 3300049581 Bacteria 2380
119 Ga0501047_0221112 3300049581 Bacteria 1750
120 Ga0501075_0199050 3300049591 Unclassified 1528
121 Ga0501076_0172264 3300049592 Bacteria 1764
122 Ga0501077_0598258 3300049593 Bacteria 708
123 Ga0501081_0138037 3300049743 Bacteria 1746
124 Ga0501035_0013190 3300049822 Bacteria 7628
125 Ga0501035_0014399 3300049822 Bacteria 7300
126 Ga0501044_0000024 3300049823 Bacteria 194302
127 Ga0501044_0009853 3300049823 Bacteria 10386
128 nmdc:mga0k408_65807_c1 3300050493 Bacteria 2110
129 nmdc:mga0a205_304745_c1 3300050515 Bacteria 1465
130 Ga0495601_0428699 3300053077 Bacteria 856
131 Ga0495619_0016683 3300053085 Bacteria 4647
132 Ga0500608_001301 3300053122 Bacteria 8887
133 Ga0500604_0120049 3300053151 Bacteria 878
134 Ga0500616_0004949 3300053153 Bacteria 9247
135 Ga0500622_0011951 3300053156 Bacteria 4721
136 Ga0530510_0099156 3300061734 Unclassified 2130
137 JGI25406J46586_10002322
138 Ga0065714_10070250
139 Ga0070658_10598890
140 Ga0070683_100039960
141 Ga0070667_101830243
142 Ga0070711_100045151
143 Ga0070705_100000064
144 Ga0070700_101078123
145 Ga0070686_100983578
146 Ga0068855_100017709
147 Ga0068855_100229448
148 Ga0068855_100674146
149 Ga0068857_100890862
150 Ga0068857_101198043
151 Ga0068854_101884553
152 Ga0068856_100000160
153 Ga0068856_100003820
154 Ga0068856_100040298
155 Ga0068859_100634089
156 Ga0068859_101012921
157 Ga0068863_101335449
158 Ga0068860_100608711
159 Ga0081539_10003514
160 Ga0070712_100516110
161 Ga0075366_10063151
162 Ga0075433_10119132
163 Ga0075433_10427535
164 Ga0097620_100634094
165 Ga0097620_101012632
166 Ga0105240_10311663
167 Ga0105243_11139333
168 Ga0105248_11939067
169 Ga0105238_10017221
170 Ga0105238_10203558
171 Ga0105238_10442619
172 Ga0157370_11615503
173 Ga0157379_11092893
174 Ga0207643_10273942
175 Ga0207705_10289002
176 Ga0207693_10447824
177 Ga0207694_10080955
178 Ga0207694_10137978
179 Ga0207694_10226262
180 Ga0207667_10040159
181 Ga0207702_10000452
182 Ga0207702_10000885
183 Ga0207702_10051503
184 Ga0207702_10727598
185 Ga0207674_10208485
186 Ga0207674_10997107
187 Ga0265337_1002484
188 Ga0265337_1044429
189 Ga0265319_1000827
190 Ga0265318_10069947
191 Ga0265322_10117653
192 Ga0307515_10097756
193 Ga0265338_10298431
194 Ga0265338_10314924
195 Ga0265324_10011311
196 Ga0265330_10005481
197 Ga0265332_10000277
198 Ga0265328_10169056
199 Ga0265320_10000819
200 Ga0265320_10004019
201 Ga0265320_10060427
202 Ga0265320_10264914
203 Ga0265329_10005308
204 Ga0265339_10082131
205 Ga0265331_10000052
206 Ga0265327_10005731
207 Ga0265327_10226672
208 Ga0265316_10000027
209 Ga0265316_11107194
210 Ga0307513_10249235
211 Ga0307508_10000266
212 Ga0265314_10000122
213 Ga0265314_10036508
214 Ga0265314_10049202
215 Ga0265342_10010690
216 Ga0307516_10000379
217 Ga0307405_11124899
218 Ga0373924_0011459
219 Ga0373927_0027869
220 Ga0451787_322436
221 Ga0451793_0495206
222 Ga0451800_0780729
223 Ga0451841_0196224
224 Ga0453684_0008321
225 Ga0453684_0360523
226 Ga0453684_1553224
227 Ga0451576_0002847
228 Ga0495580_0760734
229 Ga0495596_0056181
230 Ga0495632_0376330
231 Ga0495643_0001581
232 Ga0495674_0493646
233 Ga0495674_1098014
234 Ga0495680_0604185
235 Ga0501291_030966
236 Ga0501292_003399
237 Ga0501300_029542
238 Ga0501031_0000004
239 Ga0501032_0010346
240 Ga0501032_0010479
241 Ga0501033_0000212
242 Ga0501034_0752196
243 Ga0501036_0363915
244 Ga0501036_0704447
245 Ga0501038_0310479
246 Ga0501038_0437626
247 Ga0501039_0145160
248 Ga0501041_0084452
249 Ga0501043_0154478
250 Ga0501046_0000465
251 Ga0501046_0009310
252 Ga0501046_0559797
253 Ga0501047_0001911
254 Ga0501047_0131730
255 Ga0501047_0221112
256 Ga0501075_0199050
257 Ga0501076_0172264
258 Ga0501077_0598258
259 Ga0501081_0138037
260 Ga0501035_0013190
261 Ga0501035_0014399
262 Ga0501044_0000024
263 Ga0501044_0009853
264 nmdc:mga0k408_65807_c1
265 nmdc:mga0a205_304745_c1
266 Ga0495601_0428699
267 Ga0495619_0016683
268 Ga0500608_001301
269 Ga0500604_0120049
270 Ga0500616_0004949
271 Ga0500622_0011951
272 Ga0530510_0099156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

6

129

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xvu-assembly2.cif.gz_C bacteriophytochrome response regulator from deinococcus radiodurans 0.9419 3 143
6xvu-assembly2.cif.gz_C bacteriophytochrome response regulator from deinococcus radiodurans 0.9225 3 143
1k68-assembly1.cif.gz_B crystal structure of the phosphorylated cyanobacterial phytochrome response regulator rcpa 0.9104 3 143
1k68-assembly1.cif.gz_B crystal structure of the phosphorylated cyanobacterial phytochrome response regulator rcpa 0.8979 3 143
3kht-assembly1.cif.gz_A crystal structure of response regulator from hahella chejuensis 0.895 3 140
ID Description Score Start End Superfamily
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9219 3 95 3.40.50.2300
1jlkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9071 3 143 3.40.50.2300
1k66B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8941 1 145 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.894 3 95 3.40.50.2300
af_P08368_2_83_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8911 3 95 3.40.50.2300
ID Description Score Start End GO Terms
AF-I6ZT77-F1-model_v4 Response regulator receiver protein 0.9682 1 142 GO:0000160
AF-I2GC00-F1-model_v4 Response regulator receiver protein 0.9655 4 140 GO:0000160
AF-A0A512BGP1-F1-model_v4 Response regulator 0.9636 3 143 GO:0000160
AF-A0A3C1YQP1-F1-model_v4 Two-component system response regulator 0.9627 4 142 GO:0000160
AF-A0A7W2GJS5-F1-model_v4 Response regulator 0.9618 2 142 GO:0000160

Map