F164772

General Info

Members Datasets Scaffolds Average Seq Length
135 122 270 105

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_139221_c1|nmdc:mga0a205_139221_c1_1224_1565
Length 113
Sequence LEVKRGAIVVVAARGAYTGKPRPALVVQSDLFNPTHQSVTICPITSDCVDAPFFRLPLPPGERTGLRSASQIMIDKIVSVPRSAITAEIGLCDSGELEAAEDALRLWLGLDAK

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
24 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
28 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
29 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
31 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
38 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
39 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
40 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
41 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
42 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
43 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
45 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
46 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
47 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
48 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
49 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
50 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
54 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
58 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
59 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
60 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
61 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
62 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
63 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
64 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
65 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
66 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
67 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
68 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
69 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
70 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
75 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
76 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
77 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
78 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
79 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
80 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
81 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
82 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
83 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
84 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
85 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
86 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
87 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
88 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
89 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
90 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
91 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
92 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
93 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
94 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
95 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
96 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
97 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
98 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
99 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
100 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
101 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
102 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
103 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
104 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
105 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
106 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
107 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
108 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
109 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
110 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
111 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
112 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
113 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
114 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
115 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
116 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
117 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
118 8005382845 Rhizobium sp. R634 Isolate Nodule
119 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
120 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
121 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
122 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.07
Metatranscriptomes 0.74
Isolates 25.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.59
Nodule 17.04
Rhizoplane 4.44
Rhizosphere 50.37
Stem 0
Stem Tuber 0
Unclassified 11.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_139221_c1 3300050515 Bacteria 2327
2 JGI25152J39213_1001407 3300002773 Bacteria 10403
3 JGI25150J39212_1000954 3300002774 Bacteria 9190
4 JGI25151J46595_10068859 3300003187 Bacteria 1083
5 JGI25153J46596_10002572 3300003215 Bacteria 10403
6 Ga0055540_1003200 3300003792 Bacteria 8046
7 Ga0070668_100162678 3300005347 Bacteria 1812
8 Ga0070675_100913404 3300005354 Bacteria 805
9 Ga0070698_100247901 3300005471 Bacteria 1714
10 Ga0070693_100906175 3300005547 Bacteria 661
11 Ga0068854_100879557 3300005578 Bacteria 786
12 Ga0068859_102386885 3300005617 Unclassified 583
13 Ga0068862_100000390 3300005844 Bacteria 47221
14 Ga0075364_10000870 3300006051 Bacteria 15928
15 Ga0075367_10481620 3300006178 Bacteria 787
16 Ga0075433_10232217 3300006852 Bacteria 1638
17 Ga0075434_100266130 3300006871 Unclassified 1733
18 Ga0075436_100014668 3300006914 Bacteria 5372
19 Ga0075436_100523279 3300006914 Bacteria 869
20 Ga0097620_102385757 3300006931 Unclassified 583
21 Ga0075435_100452415 3300007076 Bacteria 1107
22 Ga0075435_100536853 3300007076 Bacteria 1012
23 Ga0105240_10129439 3300009093 Bacteria 3029
24 Ga0105249_10061078 3300009553 Bacteria 3458
25 Ga0123341_1027030 3300009765 Bacteria 4517
26 Ga0123342_1021753 3300009766 Bacteria 4453
27 Ga0157380_10258591 3300014326 Bacteria 1580
28 Ga0157379_10080371 3300014968 Bacteria 2920
29 Ga0207425_1001347 3300025245 Bacteria 10514
30 Ga0209129_1001702 3300025258 Bacteria 11874
31 Ga0209025_1004878 3300025294 Bacteria 11308
32 Ga0209758_1002272 3300025297 Bacteria 19908
33 Ga0209051_1006783 3300025303 Bacteria 6383
34 Ga0207695_10093303 3300025913 Bacteria 3019
35 Ga0207712_10075618 3300025961 Bacteria 2435
36 Ga0207712_10304703 3300025961 Bacteria 1309
37 Ga0207668_10068275 3300025972 Bacteria 2527
38 Ga0207678_10566897 3300026067 Bacteria 994
39 Ga0268265_10000984 3300028380 Bacteria 25864
40 Ga0265332_10311059 3300031238 Bacteria 650
41 Ga0265328_10006554 3300031239 Bacteria 4910
42 Ga0265331_10000229 3300031250 Bacteria 67423
43 Ga0316579_10000992 3300031691 Bacteria 9957
44 Ga0307412_10105150 3300031911 Bacteria 2004
45 Ga0316583_10151889 3300032133 Bacteria 806
46 Ga0316593_10355436 3300032168 Unclassified 561
47 Ga0439453_0023250 3300041408 Bacteria 1130
48 Ga0451791_1647050 3300041451 Unclassified 556
49 Ga0451833_1040103 3300041491 Bacteria 1302
50 Ga0451837_0772299 3300041494 Bacteria 735
51 Ga0451849_1455412 3300041505 Bacteria 577
52 Ga0451853_0913989 3300041512 Bacteria 587
53 Ga0466969_0162255 3300044656 Bacteria 1027
54 Ga0466966_0157569 3300044684 Bacteria 1383
55 Ga0466964_0192440 3300044706 Bacteria 974
56 Ga0466957_1048783 3300044842 Bacteria 587
57 Ga0466960_0474039 3300044901 Bacteria 730
58 Ga0466958_0354953 3300045836 Bacteria 944
59 Ga0466967_0499547 3300045976 Bacteria 1193
60 Ga0466967_2494246 3300045976 Unclassified 512
61 Ga0495583_0077292 3300046506 Bacteria 1452
62 Ga0495654_0000436 3300046530 Bacteria 35437
63 Ga0495599_0100802 3300046678 Bacteria 1800
64 Ga0495671_0173162 3300046692 Bacteria 1049
65 Ga0496101_0448530 3300048904 Bacteria 1018
66 Ga0496110_0667409 3300048913 Bacteria 940
67 Ga0496111_0023141 3300048914 Bacteria 4359
68 Ga0496119_0030295 3300048922 Bacteria 3652
69 Ga0496120_0065672 3300048923 Bacteria 2009
70 Ga0496121_0012314 3300048924 Bacteria 9354
71 Ga0496121_0044292 3300048924 Bacteria 3840
72 Ga0496121_0316600 3300048924 Bacteria 1052
73 Ga0496122_0027268 3300048925 Bacteria 4888
74 Ga0496123_0006783 3300048926 Bacteria 11002
75 Ga0496124_0042005 3300048927 Bacteria 3940
76 Ga0501040_0565962 3300049576 Unclassified 820
77 Ga0501042_0139799 3300049578 Unclassified 1746
78 Ga0501046_0503619 3300049580 Unclassified 867
79 Ga0501071_0220699 3300049587 Bacteria 1427
80 Ga0501075_0466754 3300049591 Unclassified 963
81 Ga0501077_0607340 3300049593 Unclassified 703
82 Ga0501077_0892830 3300049593 Bacteria 572
83 Ga0501079_0102834 3300049741 Bacteria 2216
84 Ga0501080_0862710 3300049742 Bacteria 791
85 Ga0501081_0336900 3300049743 Unclassified 1110
86 Ga0501081_0605320 3300049743 Unclassified 820
87 Ga0501083_0252294 3300049744 Unclassified 1148
88 nmdc:mga00v17_2702_c1 3300050491 Bacteria 9102
89 nmdc:mga06z11_250713_c1 3300050494 Bacteria 1042
90 nmdc:mga08y16_122742_c1 3300050511 Unclassified 2703
91 nmdc:mga0n895_172910_c1 3300050512 Bacteria 2192
92 nmdc:mga0n895_243623_c1 3300050512 Unclassified 1825
93 nmdc:mga0n895_463720_c1 3300050512 Bacteria 1278
94 nmdc:mga0rr50_521811_c1 3300050513 Bacteria 1011
95 nmdc:mga08x19_164532_c1 3300050514 Bacteria 1508
96 nmdc:mga08x19_430929_c1 3300050514 Bacteria 927
97 Ga0500566_0229142 3300053094 Bacteria 918
98 Ga0500562_108851 3300053108 Bacteria 755
99 Ga0500568_0097455 3300053139 Bacteria 1105
100 Ga0501084_1091283 3300054114 Bacteria 670
101 Ga0501084_1310920 3300054114 Bacteria 607
102 2511193509 2510917030 Bacteria 7460662
103 2524463028 2524023209 Bacteria 6679728
104 2530644765 2529292951 Bacteria 6916614
105 2535520712 2534681796 Bacteria 7146037
106 2599719417 2599185236 Bacteria 6875203
107 2600200817 2599185354 Bacteria 4398675
108 2616311812 2615840626 Bacteria 7921970
109 2753765213 2751185897 Bacteria 5322941
110 2778176723 2775507266 Bacteria 7392367
111 2819242728 2818991272 Bacteria 4622173
112 2821123777 2821123053 Bacteria 7836056
113 2838034467 2838029111 Bacteria 6603031
114 2838739193 2838736955 Bacteria 5760694
115 2841843091 2841840854 Bacteria 5761912
116 2842142873 2842140634 Bacteria 5759631
117 2842302166 2842298080 Bacteria 6123127
118 2842363169 2842357229 Bacteria 6485165
119 2842481214 2842475841 Bacteria 6603183
120 2842489124 2842482326 Bacteria 7212537
121 2842508201 2842502639 Bacteria 6604161
122 2842513918 2842509118 Bacteria 6850950
123 2842701095 2842698319 Bacteria 5190321
124 2852392400 2852387548 Bacteria 8025568
125 2857531339 2857531043 Bacteria 6754041
126 2960619699 2960617483 Bacteria 6727748
127 2960662667 2960660292 Bacteria 7041660
128 2977523927 2977523885 Bacteria 6960446
129 2977524166 2977523885 Bacteria 6960446
130 3005454038 3005452660 Bacteria 5889319
131 8005388688 8005382845 Bacteria 6732062
132 8005548478 8005542996 Bacteria 7077758
133 8046770055 8046767195 Bacteria 7547379
134 8054307603 8054302542 Bacteria 5698134
135 8057581455 8057575449 Bacteria 7367519
136 nmdc:mga0a205_139221_c1
137 JGI25152J39213_1001407
138 JGI25150J39212_1000954
139 JGI25151J46595_10068859
140 JGI25153J46596_10002572
141 Ga0055540_1003200
142 Ga0070668_100162678
143 Ga0070675_100913404
144 Ga0070698_100247901
145 Ga0070693_100906175
146 Ga0068854_100879557
147 Ga0068859_102386885
148 Ga0068862_100000390
149 Ga0075364_10000870
150 Ga0075367_10481620
151 Ga0075433_10232217
152 Ga0075434_100266130
153 Ga0075436_100014668
154 Ga0075436_100523279
155 Ga0097620_102385757
156 Ga0075435_100452415
157 Ga0075435_100536853
158 Ga0105240_10129439
159 Ga0105249_10061078
160 Ga0123341_1027030
161 Ga0123342_1021753
162 Ga0157380_10258591
163 Ga0157379_10080371
164 Ga0207425_1001347
165 Ga0209129_1001702
166 Ga0209025_1004878
167 Ga0209758_1002272
168 Ga0209051_1006783
169 Ga0207695_10093303
170 Ga0207712_10075618
171 Ga0207712_10304703
172 Ga0207668_10068275
173 Ga0207678_10566897
174 Ga0268265_10000984
175 Ga0265332_10311059
176 Ga0265328_10006554
177 Ga0265331_10000229
178 Ga0316579_10000992
179 Ga0307412_10105150
180 Ga0316583_10151889
181 Ga0316593_10355436
182 Ga0439453_0023250
183 Ga0451791_1647050
184 Ga0451833_1040103
185 Ga0451837_0772299
186 Ga0451849_1455412
187 Ga0451853_0913989
188 Ga0466969_0162255
189 Ga0466966_0157569
190 Ga0466964_0192440
191 Ga0466957_1048783
192 Ga0466960_0474039
193 Ga0466958_0354953
194 Ga0466967_0499547
195 Ga0466967_2494246
196 Ga0495583_0077292
197 Ga0495654_0000436
198 Ga0495599_0100802
199 Ga0495671_0173162
200 Ga0496101_0448530
201 Ga0496110_0667409
202 Ga0496111_0023141
203 Ga0496119_0030295
204 Ga0496120_0065672
205 Ga0496121_0012314
206 Ga0496121_0044292
207 Ga0496121_0316600
208 Ga0496122_0027268
209 Ga0496123_0006783
210 Ga0496124_0042005
211 Ga0501040_0565962
212 Ga0501042_0139799
213 Ga0501046_0503619
214 Ga0501071_0220699
215 Ga0501075_0466754
216 Ga0501077_0607340
217 Ga0501077_0892830
218 Ga0501079_0102834
219 Ga0501080_0862710
220 Ga0501081_0336900
221 Ga0501081_0605320
222 Ga0501083_0252294
223 nmdc:mga00v17_2702_c1
224 nmdc:mga06z11_250713_c1
225 nmdc:mga08y16_122742_c1
226 nmdc:mga0n895_172910_c1
227 nmdc:mga0n895_243623_c1
228 nmdc:mga0n895_463720_c1
229 nmdc:mga0rr50_521811_c1
230 nmdc:mga08x19_164532_c1
231 nmdc:mga08x19_430929_c1
232 Ga0500566_0229142
233 Ga0500562_108851
234 Ga0500568_0097455
235 Ga0501084_1091283
236 Ga0501084_1310920
237 2511193509
238 2524463028
239 2530644765
240 2535520712
241 2599719417
242 2600200817
243 2616311812
244 2753765213
245 2778176723
246 2819242728
247 2821123777
248 2838034467
249 2838739193
250 2841843091
251 2842142873
252 2842302166
253 2842363169
254 2842481214
255 2842489124
256 2842508201
257 2842513918
258 2842701095
259 2852392400
260 2857531339
261 2960619699
262 2960662667
263 2977523927
264 2977524166
265 3005454038
266 8005388688
267 8005548478
268 8046770055
269 8054307603
270 8057581455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

4

108

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kyt-assembly1.cif.gz_K the structure of the m. tb toxin mazef-mt1 complex 0.9173 1 107
5uct-assembly1.cif.gz_A-2 mycobacterium tuberculosis toxin mazf-mt6 0.9155 5 107
6kyt-assembly1.cif.gz_K the structure of the m. tb toxin mazef-mt1 complex 0.9092 1 107
5hjz-assembly1.cif.gz_A structure of m. tuberculosis mazf-mt1 (rv2801c) in complex with rna 0.9045 1 105
4me7-assembly1.cif.gz_A crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze 0.901 1 107
ID Description Score Start End Superfamily
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9076 3 107 2.30.30.110
af_P71650_1_116_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9002 1 105 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8993 3 107 2.30.30.110
af_P9WII1_5_102_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8992 6 105 2.30.30.110
4hkeA00 Mainly Beta;Roll;SH3 type barrels.; 0.8861 1 107 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A1G5SRV3-F1-model_v4 mRNA interferase MazF 0.988 1 94 GO:0003677
AF-A0A7W4GRZ9-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9861 23 107 GO:0003677
AF-A0A165LYW9-F1-model_v4 Growth inhibitor PemK 0.9846 1 107 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A1B1NGP3-F1-model_v4 PemK-like protein superfamily 0.9843 29 107 GO:0003677
AF-A0A1W2ENK7-F1-model_v4 mRNA interferase MazF 0.9831 2 107 GO:0003677
GO:0004521
GO:0006402
GO:0016075

Map