F164752

General Info

Members Datasets Scaffolds Average Seq Length
135 99 270 490

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_6672_c1|nmdc:mga06r32_6672_c1_2651_4198
Length 515
Sequence MSLSDQVLFRHRRLEGKMAAFILAIDQGTTSSRAIVFDARCKVVASAQQEFKQYFPRSGWVEHDAEEIWRTVVSTGRSVLKKARVRPKEIAGIGITNQRETTLVWDRSTGKPVHRAIVWQDRRTADMCLALKKAGHETNVSAQTGLLLDPYFSGTKIAWILDNVAGARKRAEQGELAFGTVDSFLIWRLTGGRQHATDATNASRTLLYNIHKGEWDDDLLALMGVPRAMLPEVKDSSAEFGGTEAAIFGTPLAIRGDAGDQQAATVGQACFRPGMIKSTYGTGCFAMLNTGEQAVQSRNRLLTTIAYQLNGKPSYALEGSIFIAGAAVQWLRDGLRIIKKAADSAALAAKADPHQAVYLVPAFVGLGAPYWDPDARGSIHGLTRGTSAAELCRAALESVCYQTRDLLEAMQGDWHGGASTETVLRVDGGMTASEWTMQFLADILNAPVDRPKVMETTALGAAYLAGLQAGLYPEPSEFGKNWRLDKRFLPKMKEDNRGQKYSGWKDAVRRTLSQK

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
5 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
22 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
23 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
31 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
32 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
33 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
34 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
35 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
36 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
37 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
40 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
41 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
47 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
48 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
49 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
50 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
51 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
52 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
53 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
54 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
55 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
56 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
57 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
58 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
59 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
60 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
61 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
62 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
63 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
64 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
75 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
76 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
77 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
78 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
79 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
82 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
85 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
86 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
87 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
88 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
89 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
90 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
91 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
92 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
93 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
94 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
95 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
96 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
97 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
98 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
99 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.85
Metatranscriptomes 0
Isolates 8.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0
Rhizoplane 1.48
Rhizosphere 88.15
Stem 0
Stem Tuber 0.74
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_6672_c1 3300050510 Bacteria 10374
2 Ga0070658_10001982 3300005327 Bacteria 17215
3 Ga0070658_10072185 3300005327 Bacteria 2828
4 Ga0070713_100066023 3300005436 Bacteria 3041
5 Ga0070679_100023803 3300005530 Bacteria 6000
6 Ga0070665_100034905 3300005548 Bacteria 5059
7 Ga0068855_100236553 3300005563 Bacteria 2043
8 Ga0068855_100270820 3300005563 Bacteria 1888
9 Ga0068855_100293096 3300005563 Bacteria 1803
10 Ga0068859_100077325 3300005617 Bacteria 3369
11 Ga0081455_10074504 3300005937 Bacteria 2804
12 Ga0081455_10150099 3300005937 Bacteria 1798
13 Ga0081539_10005058 3300005985 Bacteria 13838
14 Ga0075365_10127248 3300006038 Bacteria 1761
15 Ga0075362_10013290 3300006177 Bacteria 3293
16 Ga0075367_10004523 3300006178 Bacteria 6799
17 Ga0075428_100047126 3300006844 Bacteria 4735
18 Ga0075431_100014099 3300006847 Bacteria 8079
19 Ga0097620_100077325 3300006931 Bacteria 3369
20 Ga0099794_10037063 3300007265 Bacteria 2308
21 Ga0105240_10150217 3300009093 Bacteria 2776
22 Ga0105249_10000344 3300009553 Bacteria 46859
23 Ga0157374_10137616 3300013296 Bacteria 2369
24 Ga0182008_10081614 3300014497 Bacteria 1591
25 Ga0157376_10002484 3300014969 Bacteria 12476
26 Ga0213872_10000608 3300021361 Bacteria 27115
27 Ga0213872_10001447 3300021361 Bacteria 15447
28 Ga0213872_10001950 3300021361 Bacteria 12581
29 Ga0213872_10019336 3300021361 Bacteria 3137
30 Ga0213872_10035514 3300021361 Bacteria 2279
31 Ga0207684_10101407 3300025910 Bacteria 2461
32 Ga0207706_10018586 3300025933 Bacteria 6254
33 Ga0207667_10090386 3300025949 Bacteria 3164
34 Ga0207712_10000226 3300025961 Bacteria 55648
35 Ga0207674_10121324 3300026116 Bacteria 2581
36 Ga0207683_10014835 3300026121 Bacteria 6634
37 Ga0307515_10110485 3300028794 Bacteria 3216
38 Ga0265330_10022838 3300031235 Bacteria 2844
39 Ga0265339_10000427 3300031249 Bacteria 33315
40 Ga0265331_10003992 3300031250 Bacteria 9325
41 Ga0265313_10042821 3300031595 Bacteria 2221
42 Ga0316575_10001783 3300031665 Bacteria 7057
43 Ga0265314_10000414 3300031711 Bacteria 57450
44 Ga0265342_10012299 3300031712 Bacteria 5801
45 Ga0316576_10007910 3300031727 Bacteria 6729
46 Ga0316576_10011036 3300031727 Bacteria 5898
47 Ga0316576_10017705 3300031727 Bacteria 4848
48 Ga0307409_100025400 3300031995 Bacteria 4155
49 Ga0316583_10016315 3300032133 Bacteria 2673
50 Ga0373942_0012629 3300035207 Bacteria 2022
51 Ga0395899_0037635 3300037312 Bacteria 3627
52 Ga0395900_0104680 3300037418 Bacteria 2907
53 Ga0395900_0132817 3300037418 Bacteria 2550
54 Ga0395898_0094716 3300037466 Bacteria 2870
55 Ga0395905_0014177 3300037471 Bacteria 7616
56 Ga0395901_0011442 3300038443 Bacteria 8990
57 Ga0395901_0075903 3300038443 Bacteria 3506
58 Ga0395901_0120041 3300038443 Bacteria 2762
59 Ga0400483_024995 3300039062 Bacteria 31499
60 Ga0400483_108658 3300039062 Bacteria 9905
61 Ga0400483_168038 3300039062 Bacteria 11008
62 Ga0400483_238315 3300039062 Bacteria 22298
63 Ga0436361_0310984 3300039447 Bacteria 5148
64 Ga0436361_0460808 3300039447 Bacteria 7453
65 Ga0451576_0011338 3300045051 Bacteria 10143
66 Ga0466967_0032121 3300045976 Bacteria 4429
67 Ga0495603_0066898 3300046455 Bacteria 2116
68 Ga0495638_0000507 3300046460 Bacteria 46001
69 Ga0495580_0073544 3300046472 Bacteria 2386
70 Ga0495582_0003894 3300046473 Bacteria 8394
71 Ga0495639_0004096 3300046475 Bacteria 6245
72 Ga0495662_0070644 3300046476 Bacteria 1692
73 Ga0495666_0062783 3300046526 Bacteria 1774
74 Ga0495586_0034328 3300046535 Bacteria 2724
75 Ga0495647_0003823 3300046681 Bacteria 4848
76 Ga0495613_0001902 3300046689 Bacteria 15829
77 Ga0495581_0012408 3300047315 Bacteria 4937
78 Ga0495614_0038852 3300048089 Bacteria 2043
79 Ga0496101_0045522 3300048904 Bacteria 3143
80 Ga0496115_0003306 3300048918 Bacteria 11575
81 Ga0501031_0017429 3300049568 Bacteria 4667
82 Ga0501033_0094575 3300049570 Bacteria 2185
83 Ga0501034_0023821 3300049571 Bacteria 6234
84 Ga0501034_0039938 3300049571 Bacteria 4752
85 Ga0501034_0163309 3300049571 Bacteria 2197
86 Ga0501039_0033336 3300049575 Bacteria 3971
87 Ga0501041_0008273 3300049577 Bacteria 6120
88 Ga0501042_0015973 3300049578 Bacteria 5150
89 Ga0501042_0015996 3300049578 Bacteria 5146
90 Ga0501043_0011031 3300049579 Bacteria 7079
91 Ga0501043_0087068 3300049579 Bacteria 2455
92 Ga0501043_0109088 3300049579 Bacteria 2174
93 Ga0501046_0047811 3300049580 Bacteria 3391
94 Ga0501046_0104227 3300049580 Bacteria 2174
95 Ga0501046_0139511 3300049580 Bacteria 1835
96 Ga0501047_0028834 3300049581 Bacteria 5354
97 Ga0501047_0045558 3300049581 Bacteria 4241
98 Ga0501071_0015829 3300049587 Bacteria 5181
99 Ga0501072_0019827 3300049588 Bacteria 5204
100 Ga0501074_0045812 3300049590 Bacteria 3163
101 Ga0501075_0003703 3300049591 Bacteria 10264
102 Ga0501075_0006146 3300049591 Bacteria 8254
103 Ga0501076_0008313 3300049592 Bacteria 7605
104 Ga0501076_0059168 3300049592 Bacteria 3047
105 Ga0501077_0016427 3300049593 Bacteria 4663
106 Ga0501079_0003400 3300049741 Bacteria 11680
107 Ga0501079_0007476 3300049741 Bacteria 8262
108 Ga0501080_0068573 3300049742 Bacteria 3299
109 Ga0501080_0072685 3300049742 Bacteria 3200
110 Ga0501081_0037672 3300049743 Bacteria 3300
111 Ga0501035_0017992 3300049822 Bacteria 6516
112 Ga0501035_0037903 3300049822 Bacteria 4364
113 Ga0501044_0010540 3300049823 Bacteria 10026
114 Ga0501044_0124808 3300049823 Bacteria 2572
115 Ga0501045_0001466 3300049824 Bacteria 15696
116 Ga0501045_0003756 3300049824 Bacteria 10441
117 Ga0500559_0000029 3300053136 Bacteria 117549
118 Ga0501084_0023276 3300054114 Bacteria 5172
119 Ga0501082_0000904 3300060353 Bacteria 26090
120 Ga0501082_0026393 3300060353 Bacteria 5005
121 Ga0501082_0286196 3300060353 Bacteria 1435
122 Ga0530510_0000307 3300061734 Bacteria 31232
123 Ga0530510_0109722 3300061734 Bacteria 2020
124 Ga0530510_0146190 3300061734 Bacteria 1743
125 2512733665 2512564039 Bacteria 8739048
126 2523107519 2522572158 Bacteria 6514390
127 2643754671 2643221547 Bacteria 4740017
128 2854682025 2854681122 Bacteria 4548679
129 2855023529 2855020534 Bacteria 3204685
130 2882461991 2882456835 Bacteria 6863978
131 2883581579 2883577096 Bacteria 4709178
132 2899260467 2899259804 Bacteria 3320927
133 2899277300 2899275550 Bacteria 3958688
134 3000409105 3000405567 Bacteria 3779330
135 8057136798 8057132660 Bacteria 4061191
136 nmdc:mga06r32_6672_c1
137 Ga0070658_10001982
138 Ga0070658_10072185
139 Ga0070713_100066023
140 Ga0070679_100023803
141 Ga0070665_100034905
142 Ga0068855_100236553
143 Ga0068855_100270820
144 Ga0068855_100293096
145 Ga0068859_100077325
146 Ga0081455_10074504
147 Ga0081455_10150099
148 Ga0081539_10005058
149 Ga0075365_10127248
150 Ga0075362_10013290
151 Ga0075367_10004523
152 Ga0075428_100047126
153 Ga0075431_100014099
154 Ga0097620_100077325
155 Ga0099794_10037063
156 Ga0105240_10150217
157 Ga0105249_10000344
158 Ga0157374_10137616
159 Ga0182008_10081614
160 Ga0157376_10002484
161 Ga0213872_10000608
162 Ga0213872_10001447
163 Ga0213872_10001950
164 Ga0213872_10019336
165 Ga0213872_10035514
166 Ga0207684_10101407
167 Ga0207706_10018586
168 Ga0207667_10090386
169 Ga0207712_10000226
170 Ga0207674_10121324
171 Ga0207683_10014835
172 Ga0307515_10110485
173 Ga0265330_10022838
174 Ga0265339_10000427
175 Ga0265331_10003992
176 Ga0265313_10042821
177 Ga0316575_10001783
178 Ga0265314_10000414
179 Ga0265342_10012299
180 Ga0316576_10007910
181 Ga0316576_10011036
182 Ga0316576_10017705
183 Ga0307409_100025400
184 Ga0316583_10016315
185 Ga0373942_0012629
186 Ga0395899_0037635
187 Ga0395900_0104680
188 Ga0395900_0132817
189 Ga0395898_0094716
190 Ga0395905_0014177
191 Ga0395901_0011442
192 Ga0395901_0075903
193 Ga0395901_0120041
194 Ga0400483_024995
195 Ga0400483_108658
196 Ga0400483_168038
197 Ga0400483_238315
198 Ga0436361_0310984
199 Ga0436361_0460808
200 Ga0451576_0011338
201 Ga0466967_0032121
202 Ga0495603_0066898
203 Ga0495638_0000507
204 Ga0495580_0073544
205 Ga0495582_0003894
206 Ga0495639_0004096
207 Ga0495662_0070644
208 Ga0495666_0062783
209 Ga0495586_0034328
210 Ga0495647_0003823
211 Ga0495613_0001902
212 Ga0495581_0012408
213 Ga0495614_0038852
214 Ga0496101_0045522
215 Ga0496115_0003306
216 Ga0501031_0017429
217 Ga0501033_0094575
218 Ga0501034_0023821
219 Ga0501034_0039938
220 Ga0501034_0163309
221 Ga0501039_0033336
222 Ga0501041_0008273
223 Ga0501042_0015973
224 Ga0501042_0015996
225 Ga0501043_0011031
226 Ga0501043_0087068
227 Ga0501043_0109088
228 Ga0501046_0047811
229 Ga0501046_0104227
230 Ga0501046_0139511
231 Ga0501047_0028834
232 Ga0501047_0045558
233 Ga0501071_0015829
234 Ga0501072_0019827
235 Ga0501074_0045812
236 Ga0501075_0003703
237 Ga0501075_0006146
238 Ga0501076_0008313
239 Ga0501076_0059168
240 Ga0501077_0016427
241 Ga0501079_0003400
242 Ga0501079_0007476
243 Ga0501080_0068573
244 Ga0501080_0072685
245 Ga0501081_0037672
246 Ga0501035_0017992
247 Ga0501035_0037903
248 Ga0501044_0010540
249 Ga0501044_0124808
250 Ga0501045_0001466
251 Ga0501045_0003756
252 Ga0500559_0000029
253 Ga0501084_0023276
254 Ga0501082_0000904
255 Ga0501082_0026393
256 Ga0501082_0286196
257 Ga0530510_0000307
258 Ga0530510_0109722
259 Ga0530510_0146190
260 2512733665
261 2523107519
262 2643754671
263 2854682025
264 2855023529
265 2882461991
266 2883581579
267 2899260467
268 2899277300
269 3000409105
270 8057136798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00370

FGGY_N

FGGY family of carbohydrate kinases, N-terminal domain

21

267

0.97

PF02782

FGGY_C

FGGY family of carbohydrate kinases, C-terminal domain

276

469

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k76-assembly1.cif.gz_A glycerol kinase form thermococcus kodakarensis, complex structure with substrate. 0.9812 11 496
4e1j-assembly2.cif.gz_B crystal structure of glycerol kinase in complex with glycerol from sinorhizobium meliloti 1021 0.9801 9 495
3h45-assembly1.cif.gz_O glycerol kinase h232e with ethylene glycol 0.9786 6 495
2dpn-assembly1.cif.gz_B crystal structure of the glycerol kinase from thermus thermophilus hb8 0.9781 11 496
6k76-assembly1.cif.gz_B-2 glycerol kinase form thermococcus kodakarensis, complex structure with substrate. 0.9771 7 496
ID Description Score Start End Superfamily
4e1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9976 9 255 3.30.420.40
1gleG01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9869 8 256 3.30.420.40
4e1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9856 9 255 3.30.420.40
af_Q63060_9_266_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9583 7 254 3.30.420.40
af_Q21944_255_502_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9551 258 497 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A352CJM4-F1-model_v4 Glycerol kinase 0.9986 9 140 GO:0004370
GO:0005829
GO:0019563
AF-A0A4R9B0T7-F1-model_v4 Glycerol kinase 0.9979 7 112 GO:0004370
GO:0005829
GO:0019563
AF-A0A7V8VIS3-F1-model_v4 Glycerol kinase 0.9979 7 84 GO:0004370
GO:0005829
GO:0019563
AF-A0A3B9XVS2-F1-model_v4 Glycerol kinase 0.9977 7 290 GO:0004370
GO:0005829
GO:0019563
AF-A0A352CXX8-F1-model_v4 deleted 0.9977 7 148

Map