F163610

General Info

Members Datasets Scaffolds Average Seq Length
135 65 134 473

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10024845|Ga0265323_100248452
Length 526
Sequence MSLAYETIRAALAAQPLFEAKSWQLSPEAWPLTPDQVAELEAIGAACLEFHEALETLYFRSVAGKNLLRNKPLLAPWVADYLDRGKPRELVVHARDPKNRGVFPNVLRPDLLLTDDGFVLTELDSVPGGIGLTEFLNRLYGEETRTEAAGRQLANPNLEIRNKSETSNPESGPVAERLPVPHGSESASATQNAKPQTQNSSGVLGENDAMIRGFYASLAALRPDASNPAIALVVSDEAATYRPEMEWLALQLQLLGKRVYCLRPDRIFPLGSALFFDVEGNPEKIDIVYRFFELFDLANIRTAPFFLEAWQAGEVAIAPPMRHFQEEKLALALFHHHRLQEFWTEILGRRTLELLRQIIPPTWVLDAAPLPPGAVLDGPHVGGRPLHDWRELAGASQKERDLIIKISGYHETAWGARSVVLGSDCSRDEWQFGLDRALELAPTNLHVLQAYRKPKRVQHPVYRRPEKGGAPAVAAAEAGRLRLCPYYFVVEGRARLSGALATFCPPDKKIIHGMQDAALLPCRVTA

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
13 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
14 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
20 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
21 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
22 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
23 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
24 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
25 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
26 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
27 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
28 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
29 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
30 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
31 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
32 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
37 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
38 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
39 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
45 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
48 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
49 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
50 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
51 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
52 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
61 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
62 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
64 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
65 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 0
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10025651 3300003320 Bacteria 4765
2 rootH2_10075803 3300003320 Bacteria 6199
3 rootL2_10025387 3300003322 Bacteria 10254
4 rootL2_10329892 3300003322 Unclassified 2108
5 rootH1_10204093 3300003323 Bacteria 2645
6 Ga0070683_100015992 3300005329 Bacteria 6602
7 Ga0070683_100189456 3300005329 Bacteria 1953
8 Ga0068869_100000064 3300005334 Bacteria 47699
9 Ga0068867_100007187 3300005459 Bacteria 7870
10 Ga0070679_100001704 3300005530 Bacteria 19803
11 Ga0068856_100028688 3300005614 Bacteria 5437
12 Ga0068856_100050287 3300005614 Bacteria 4109
13 Ga0068864_100272566 3300005618 Bacteria 1577
14 Ga0070717_10000015 3300006028 Bacteria 208620
15 Ga0097621_100004656 3300006237 Bacteria 9581
16 Ga0068871_100002960 3300006358 Bacteria 11654
17 Ga0207652_10006008 3300025921 Bacteria 9825
18 Ga0207689_10000955 3300025942 Bacteria 27814
19 Ga0207661_10001565 3300025944 Bacteria 15573
20 Ga0207702_10004030 3300026078 Bacteria 13192
21 Ga0207648_10014097 3300026089 Bacteria 7395
22 Ga0265319_1000050 3300028563 Bacteria 97690
23 Ga0265319_1004329 3300028563 Bacteria 7048
24 Ga0265319_1005062 3300028563 Bacteria 6408
25 Ga0265319_1005943 3300028563 Bacteria 5734
26 Ga0265334_10002591 3300028573 Bacteria 8429
27 Ga0265334_10006132 3300028573 Bacteria 5208
28 Ga0265318_10000002 3300028577 Bacteria 428208
29 Ga0265318_10000524 3300028577 Bacteria 27594
30 Ga0265318_10002116 3300028577 Bacteria 10832
31 Ga0265318_10002176 3300028577 Bacteria 10610
32 Ga0265318_10002624 3300028577 Bacteria 9494
33 Ga0265318_10007086 3300028577 Bacteria 5101
34 Ga0265323_10000009 3300028653 Bacteria 115038
35 Ga0265323_10005562 3300028653 Bacteria 5347
36 Ga0265323_10008830 3300028653 Bacteria 4142
37 Ga0265323_10024845 3300028653 Bacteria 2275
38 Ga0265323_10032459 3300028653 Bacteria 1936
39 Ga0265322_10000126 3300028654 Bacteria 35415
40 Ga0265322_10004577 3300028654 Bacteria 4112
41 Ga0265322_10008787 3300028654 Bacteria 2940
42 Ga0265322_10030780 3300028654 Bacteria 1532
43 Ga0265336_10001623 3300028666 Bacteria 10016
44 Ga0265338_10000339 3300028800 Bacteria 85119
45 Ga0265338_10011695 3300028800 Bacteria 10105
46 Ga0265338_10027559 3300028800 Bacteria 5697
47 Ga0265324_10001190 3300029957 Bacteria 15510
48 Ga0265324_10002597 3300029957 Bacteria 9074
49 Ga0265330_10026600 3300031235 Bacteria 2616
50 Ga0265332_10038250 3300031238 Bacteria 2079
51 Ga0265320_10000278 3300031240 Bacteria 41319
52 Ga0265320_10001566 3300031240 Bacteria 16451
53 Ga0265320_10005332 3300031240 Bacteria 8270
54 Ga0265320_10005483 3300031240 Bacteria 8133
55 Ga0265320_10007561 3300031240 Bacteria 6733
56 Ga0265320_10009259 3300031240 Bacteria 5953
57 Ga0265320_10015579 3300031240 Bacteria 4292
58 Ga0265320_10016200 3300031240 Bacteria 4186
59 Ga0265331_10048990 3300031250 Bacteria 2030
60 Ga0265327_10000325 3300031251 Bacteria 90949
61 Ga0265327_10003471 3300031251 Bacteria 14999
62 Ga0265327_10009500 3300031251 Bacteria 7005
63 Ga0265316_10007202 3300031344 Bacteria 10510
64 Ga0265316_10007367 3300031344 Bacteria 10368
65 Ga0265316_10018832 3300031344 Bacteria 5927
66 Ga0265316_10032329 3300031344 Bacteria 4270
67 Ga0265316_10050285 3300031344 Bacteria 3278
68 Ga0265316_10056533 3300031344 Bacteria 3064
69 Ga0265316_10080136 3300031344 Bacteria 2504
70 Ga0265316_10084575 3300031344 Bacteria 2429
71 Ga0265316_10103990 3300031344 Bacteria 2156
72 Ga0307408_100000003 3300031548 Bacteria 618438
73 Ga0265313_10000016 3300031595 Bacteria 154004
74 Ga0265313_10001453 3300031595 Bacteria 22105
75 Ga0265313_10001771 3300031595 Bacteria 19787
76 Ga0265313_10001992 3300031595 Bacteria 18417
77 Ga0265313_10006230 3300031595 Bacteria 8518
78 Ga0265313_10006511 3300031595 Bacteria 8250
79 Ga0307508_10000006 3300031616 Bacteria 275479
80 Ga0265314_10000662 3300031711 Bacteria 42133
81 Ga0265314_10003649 3300031711 Bacteria 14806
82 Ga0265314_10003785 3300031711 Bacteria 14457
83 Ga0265314_10004180 3300031711 Bacteria 13571
84 Ga0265342_10007946 3300031712 Bacteria 7691
85 Ga0265342_10038121 3300031712 Bacteria 2928
86 Ga0307413_10030922 3300031824 Bacteria 3014
87 Ga0307413_10134487 3300031824 Bacteria 1698
88 Ga0307410_10000002 3300031852 Bacteria 145309
89 Ga0307409_100000246 3300031995 Bacteria 21827
90 Ga0307416_100000012 3300032002 Bacteria 296814
91 Ga0373935_0058299 3300035692 Bacteria 2466
92 Ga0395905_0000096 3300037471 Bacteria 146075
93 Ga0451577_0000087 3300042876 Bacteria 207662
94 Ga0451577_0029082 3300042876 Bacteria 4996
95 Ga0451577_0246986 3300042876 Bacteria 1615
96 Ga0453683_0006957 3300044673 Bacteria 7712
97 Ga0466966_0057070 3300044684 Bacteria 2469
98 Ga0453684_0000001 3300044712 Bacteria 2623166
99 Ga0453684_0004738 3300044712 Bacteria 28106
100 Ga0453684_0008499 3300044712 Bacteria 18358
101 Ga0453684_0029865 3300044712 Bacteria 7722
102 Ga0453684_0214148 3300044712 Bacteria 2237
103 Ga0451576_0000076 3300045051 Bacteria 245246
104 Ga0451576_0001806 3300045051 Bacteria 34920
105 Ga0451576_0005721 3300045051 Bacteria 15487
106 Ga0451576_0030761 3300045051 Bacteria 5731
107 Ga0451576_0054959 3300045051 Bacteria 4167
108 Ga0466967_0010756 3300045976 Bacteria 6880
109 Ga0501032_0000292 3300049569 Bacteria 42003
110 Ga0501032_0030722 3300049569 Bacteria 3686
111 Ga0501033_0000671 3300049570 Bacteria 31564
112 Ga0501033_0004621 3300049570 Bacteria 11023
113 Ga0501036_0016939 3300049572 Bacteria 6088
114 Ga0501037_0031658 3300049573 Bacteria 3905
115 Ga0501038_0009252 3300049574 Bacteria 9039
116 Ga0501042_0062933 3300049578 Bacteria 2651
117 Ga0501043_0018388 3300049579 Bacteria 5480
118 Ga0501046_0001682 3300049580 Bacteria 21153
119 Ga0501046_0027988 3300049580 Bacteria 4593
120 Ga0501047_0013226 3300049581 Bacteria 7816
121 Ga0501047_0034723 3300049581 Bacteria 4868
122 Ga0501047_0063004 3300049581 Bacteria 3577
123 Ga0501048_0079578 3300049582 Bacteria 2313
124 Ga0501243_000275 3300049675 Bacteria 6627
125 Ga0501083_0008072 3300049744 Bacteria 7445
126 Ga0501083_0019806 3300049744 Bacteria 4683
127 Ga0501083_0027142 3300049744 Bacteria 3952
128 Ga0501035_0000168 3300049822 Bacteria 80065
129 Ga0501035_0008712 3300049822 Bacteria 9445
130 Ga0501044_0000025 3300049823 Bacteria 187867
131 Ga0501044_0006748 3300049823 Bacteria 12656
132 Ga0501044_0014222 3300049823 Bacteria 8594
133 Ga0500588_0010117 3300053146 Bacteria 2267
134 Ga0500622_0026787 3300053156 Bacteria 3040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0008072 Ga0501083_0008072_60_1244 389
2 3300049580 Ga0501046_0027988 Ga0501046_0027988_2968_4170 400
3 3300045051 Ga0451576_0000076 Ga0451576_0000076_217459_218877 439
4 3300045051 Ga0451576_0005721 Ga0451576_0005721_1304_2722 440
5 3300031240 Ga0265320_10005332 Ga0265320_100053322 441
6 3300031595 Ga0265313_10000016 Ga0265313_1000001615 441
7 3300045051 Ga0451576_0054959 Ga0451576_0054959_1008_2453 453
8 3300028573 Ga0265334_10002591 Ga0265334_100025913 460
9 3300028577 Ga0265318_10000002 Ga0265318_10000002301 460
10 3300031240 Ga0265320_10016200 Ga0265320_100162002 460
11 3300031250 Ga0265331_10048990 Ga0265331_100489902 460
12 3300031344 Ga0265316_10103990 Ga0265316_101039902 460
13 3300031595 Ga0265313_10006511 Ga0265313_100065112 460
14 3300031711 Ga0265314_10003785 Ga0265314_100037855 460
15 3300044712 Ga0453684_0008499 Ga0453684_0008499_14243_15685 460
16 3300031238 Ga0265332_10038250 Ga0265332_100382502 461
17 3300031595 Ga0265313_10001453 Ga0265313_100014534 461
18 3300035692 Ga0373935_0058299 Ga0373935_0058299_414_1853 461
19 3300042876 Ga0451577_0246986 Ga0451577_0246986_27_1454 461
20 3300044712 Ga0453684_0004738 Ga0453684_0004738_12403_13830 461
21 3300044712 Ga0453684_0029865 Ga0453684_0029865_2738_4171 462
22 3300028653 Ga0265323_10000009 Ga0265323_1000000913 463
23 3300028653 Ga0265323_10005562 Ga0265323_100055623 463
24 3300028653 Ga0265323_10032459 Ga0265323_100324591 463
25 3300028654 Ga0265322_10000126 Ga0265322_1000012613 463
26 3300028654 Ga0265322_10004577 Ga0265322_100045773 463
27 3300031344 Ga0265316_10007367 Ga0265316_100073677 463
28 3300031344 Ga0265316_10080136 Ga0265316_100801362 463
29 3300031712 Ga0265342_10007946 Ga0265342_100079462 463
30 3300044712 Ga0453684_0000001 Ga0453684_0000001_970467_971882 463
31 iso_pu_bacteria 2786546940 2788434447 463
32 3300045051 Ga0451576_0001806 Ga0451576_0001806_9792_11231 464
33 3300005334 Ga0068869_100000064 Ga0068869_10000006421 465
34 3300005459 Ga0068867_100007187 Ga0068867_1000071872 465
35 3300006237 Ga0097621_100004656 Ga0097621_1000046562 465
36 3300006358 Ga0068871_100002960 Ga0068871_1000029606 465
37 3300025942 Ga0207689_10000955 Ga0207689_1000095516 465
38 3300026089 Ga0207648_10014097 Ga0207648_100140974 465
39 3300028563 Ga0265319_1004329 Ga0265319_10043296 465
40 3300028563 Ga0265319_1005943 Ga0265319_10059433 465
41 3300028577 Ga0265318_10000524 Ga0265318_1000052411 465
42 3300028577 Ga0265318_10002176 Ga0265318_100021767 465
43 3300028577 Ga0265318_10002624 Ga0265318_100026245 465
44 3300028577 Ga0265318_10007086 Ga0265318_100070864 465
45 3300028654 Ga0265322_10030780 Ga0265322_100307801 465
46 3300028666 Ga0265336_10001623 Ga0265336_100016233 465
47 3300028800 Ga0265338_10000339 Ga0265338_1000033987 465
48 3300028800 Ga0265338_10011695 Ga0265338_100116952 465
49 3300029957 Ga0265324_10001190 Ga0265324_1000119014 465
50 3300029957 Ga0265324_10002597 Ga0265324_100025977 465
51 3300031240 Ga0265320_10000278 Ga0265320_100002788 465
52 3300031240 Ga0265320_10001566 Ga0265320_100015667 465
53 3300031240 Ga0265320_10007561 Ga0265320_100075612 465
54 3300031344 Ga0265316_10007202 Ga0265316_100072026 465
55 3300031344 Ga0265316_10018832 Ga0265316_100188322 465
56 3300031344 Ga0265316_10056533 Ga0265316_100565334 465
57 3300031548 Ga0307408_100000003 Ga0307408_10000000383 465
58 3300031595 Ga0265313_10001771 Ga0265313_1000177115 465
59 3300031595 Ga0265313_10001992 Ga0265313_100019924 465
60 3300031711 Ga0265314_10000662 Ga0265314_100006629 465
61 3300031711 Ga0265314_10004180 Ga0265314_100041802 465
62 3300031712 Ga0265342_10038121 Ga0265342_100381212 465
63 3300031824 Ga0307413_10030922 Ga0307413_100309222 465
64 3300031852 Ga0307410_10000002 Ga0307410_1000000247 465
65 3300031995 Ga0307409_100000246 Ga0307409_1000002465 465
66 3300032002 Ga0307416_100000012 Ga0307416_10000001268 465
67 3300037471 Ga0395905_0000096 Ga0395905_0000096_31327_32823 465
68 3300049570 Ga0501033_0000671 Ga0501033_0000671_19590_21005 465
69 3300049580 Ga0501046_0001682 Ga0501046_0001682_42_1457 465
70 3300049581 Ga0501047_0063004 Ga0501047_0063004_1970_3385 465
71 3300049582 Ga0501048_0079578 Ga0501048_0079578_875_2290 465
72 3300049823 Ga0501044_0006748 Ga0501044_0006748_1279_2694 465
73 3300003322 rootL2_10329892 rootL2_103298922 466
74 3300028800 Ga0265338_10027559 Ga0265338_100275592 466
75 3300031240 Ga0265320_10005483 Ga0265320_100054837 466
76 3300044673 Ga0453683_0006957 Ga0453683_0006957_3762_5249 466
77 3300044712 Ga0453684_0214148 Ga0453684_0214148_66_1583 466
78 3300049569 Ga0501032_0030722 Ga0501032_0030722_1453_2871 466
79 3300049570 Ga0501033_0004621 Ga0501033_0004621_667_2085 466
80 3300049572 Ga0501036_0016939 Ga0501036_0016939_3963_5381 466
81 3300049573 Ga0501037_0031658 Ga0501037_0031658_1361_2779 466
82 3300049574 Ga0501038_0009252 Ga0501038_0009252_3743_5161 466
83 3300049578 Ga0501042_0062933 Ga0501042_0062933_719_2137 466
84 3300049744 Ga0501083_0019806 Ga0501083_0019806_851_2269 466
85 3300049822 Ga0501035_0008712 Ga0501035_0008712_4285_5703 466
86 3300049823 Ga0501044_0014222 Ga0501044_0014222_1476_2894 466
87 3300003322 rootL2_10025387 rootL2_100253876 467
88 3300005329 Ga0070683_100015992 Ga0070683_1000159922 467
89 3300005329 Ga0070683_100189456 Ga0070683_1001894562 467
90 3300005614 Ga0068856_100028688 Ga0068856_1000286883 467
91 3300005618 Ga0068864_100272566 Ga0068864_1002725661 467
92 3300006028 Ga0070717_10000015 Ga0070717_1000001571 467
93 3300025944 Ga0207661_10001565 Ga0207661_100015655 467
94 3300028563 Ga0265319_1000050 Ga0265319_100005032 467
95 3300028563 Ga0265319_1005062 Ga0265319_10050622 467
96 3300028573 Ga0265334_10006132 Ga0265334_100061322 467
97 3300028577 Ga0265318_10002116 Ga0265318_100021164 467
98 3300028654 Ga0265322_10008787 Ga0265322_100087872 467
99 3300031235 Ga0265330_10026600 Ga0265330_100266002 467
100 3300031240 Ga0265320_10009259 Ga0265320_100092592 467
101 3300031240 Ga0265320_10015579 Ga0265320_100155792 467
102 3300031251 Ga0265327_10000325 Ga0265327_100003252 467
103 3300031251 Ga0265327_10003471 Ga0265327_100034712 467
104 3300031344 Ga0265316_10032329 Ga0265316_100323292 467
105 3300031344 Ga0265316_10050285 Ga0265316_100502851 467
106 3300031616 Ga0307508_10000006 Ga0307508_10000006105 467
107 3300031711 Ga0265314_10003649 Ga0265314_100036499 467
108 3300031824 Ga0307413_10134487 Ga0307413_101344872 467
109 3300042876 Ga0451577_0029082 Ga0451577_0029082_1515_2936 467
110 3300049569 Ga0501032_0000292 Ga0501032_0000292_22693_24132 467
111 3300049579 Ga0501043_0018388 Ga0501043_0018388_805_2244 467
112 3300049581 Ga0501047_0034723 Ga0501047_0034723_2974_4413 467
113 3300049822 Ga0501035_0000168 Ga0501035_0000168_46099_47538 467
114 3300049823 Ga0501044_0000025 Ga0501044_0000025_148477_149916 467
115 3300053146 Ga0500588_0010117 Ga0500588_0010117_120_1538 467
116 3300053156 Ga0500622_0026787 Ga0500622_0026787_1165_2583 467
117 3300028653 Ga0265323_10008830 Ga0265323_100088302 468
118 3300028653 Ga0265323_10024845 Ga0265323_100248452 468
119 3300031344 Ga0265316_10084575 Ga0265316_100845752 468
120 3300042876 Ga0451577_0000087 Ga0451577_0000087_62312_63736 468
121 3300045051 Ga0451576_0030761 Ga0451576_0030761_830_2329 468
122 3300049744 Ga0501083_0027142 Ga0501083_0027142_2382_3809 468
123 3300031595 Ga0265313_10006230 Ga0265313_100062303 469
124 3300045976 Ga0466967_0010756 Ga0466967_0010756_691_2100 469
125 3300003320 rootH2_10025651 rootH2_100256512 470
126 3300003320 rootH2_10075803 rootH2_100758032 470
127 3300003323 rootH1_10204093 rootH1_102040932 470
128 3300005530 Ga0070679_100001704 Ga0070679_1000017042 470
129 3300005614 Ga0068856_100050287 Ga0068856_1000502872 470
130 3300025921 Ga0207652_10006008 Ga0207652_100060085 470
131 3300026078 Ga0207702_10004030 Ga0207702_1000403013 470
132 3300031251 Ga0265327_10009500 Ga0265327_100095002 470
133 3300044684 Ga0466966_0057070 Ga0466966_0057070_850_2370 470
134 3300049581 Ga0501047_0013226 Ga0501047_0013226_3038_4513 470
135 3300049675 Ga0501243_000275 Ga0501243_000275_4899_6323 470

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uka-assembly1.cif.gz_A ygic from escherichia coli k-12 in complex with adp 0.6965 1 468
2vpm-assembly2.cif.gz_B trypanothione synthetase 0.6901 30 467
7uka-assembly1.cif.gz_A ygic from escherichia coli k-12 in complex with adp 0.685 1 468
3n6x-assembly1.cif.gz_A crystal structure of a putative glutathionylspermidine synthase (mfla_0391) from methylobacillus flagellatus kt at 2.35 a resolution 0.6805 1 469
7uk8-assembly1.cif.gz_A apo form of ygic from escherichia coli k-12 0.6795 1 469
ID Description Score Start End Superfamily
af_E9AG92_3_283_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8694 180 212 3.75.10.10
af_Q60318_233_373_3.40.50.11900 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6935 157 212 3.40.50.11900
af_P9WL97_253_350_3.40.50.11290 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6501 174 267 3.40.50.11290
af_P9WL97_253_350_3.40.50.11290 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6234 174 267 3.40.50.11290
af_F1QXT9_78_155_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.6108 174 212 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A2E5JXW1-F1-model_v4 Nuclease 0.9774 19 470
AF-A0A2E5JXW1-F1-model_v4 Nuclease 0.9731 19 470
AF-A0A2E9RUW8-F1-model_v4 Glutathionylspermidine synthase pre-ATP-grasp-like domain-containing protein 0.9723 2 465
AF-A0A3E1DW67-F1-model_v4 Uncharacterized protein 0.9691 1 259
AF-A0A3D4HGQ9-F1-model_v4 Uncharacterized protein 0.964 3 388

Feature Viewer

pLDDT pTM Quality
88.6 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map