F161794

General Info

Members Datasets Scaffolds Average Seq Length
135 117 119 550

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10001836|JGI25406J46586_1000183610
Length 625
Sequence MNGFCEKIKIDRLLPMCPTGRLRRSDKQNKESEAKEYALKLIEKSKLVMPKYEASISLCSIKFLRYKSATQQAMLFAHQPGTIKKFLIIFAFIFLFSCANTAHTDKQVFYYNETTGVATLDPAFAKNQSVMWVVHQLYNTLVEIDSNLNIVPSLAKSWEINADRTIYTFHLLNDIYFQDNDAFANGKGRKFVANDVVYSFKRIVDPRTASSGAWIFNNRVDTANGFVALNDSTFQLKLLRPFQPILGILCMQYCSIVAHEAVEKYGKDFRSHSCGTGPFQLKYWDEGQALVLEKNQHYWERDEQGKQLPYLXAVNIXFHDNKATEFMEFRQGRLSFINDIDPSFKDEVLTKKGELRSDWKKKVILQKHSYLNTEYFGILVDEQXPLVQQSPLRLKAVRQAINYAINRPQLIMYLRNSIGTPAQAGMVPLGLPSKNAETVKGYMYNPDTARLLLQQAGIINNTPVKLLTIPIYADIASFAAKQIEDIGLKVQVEVIQKSLLLEQTAKQQALFFRGSWIGDYPDAENYMAMFYSKNPSPPNYTRYNNAAFDALYAKALQETNDSVRYALYREMDQMVIDDAPVVPLWYDEVIHLVNNNVVGFVPNALNLLELRRTKTLQTSLKRHEN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
5 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
6 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
7 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
8 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
9 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
10 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
11 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
12 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
13 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
14 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
15 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
19 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
90 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
111 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
112 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
113 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
114 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
115 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
116 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
117 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.15
Metatranscriptomes 0
Isolates 11.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.33
Nodule 0
Rhizoplane 0.74
Rhizosphere 74.07
Stem 0
Stem Tuber 0
Unclassified 11.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2499112 2162886007 Bacteria 1824
2 JGI24739J22299_10009108 3300001989 Bacteria 3702
3 JGI24751J29686_10000892 3300002459 Bacteria 6824
4 JGI25154J39366_1000042 3300002738 Bacteria 143170
5 JGI25406J46586_10001836 3300003203 Bacteria 9965
6 rootH2_10041581 3300003320 Bacteria 2682
7 JGI25160J50197_1001063 3300003354 Bacteria 14106
8 Ga0055528_1000317 3300003790 Bacteria 40640
9 Ga0055530_10001134 3300003791 Bacteria 20745
10 Ga0065704_10076026 3300005289 Bacteria 5301
11 Ga0070658_10000857 3300005327 Bacteria 25975
12 Ga0070683_100020259 3300005329 Bacteria 5917
13 Ga0070683_100126861 3300005329 Bacteria 2412
14 Ga0070690_100047178 3300005330 Bacteria 2740
15 Ga0070670_100029167 3300005331 Bacteria 4748
16 Ga0070682_100090459 3300005337 Bacteria 2001
17 Ga0068868_100091458 3300005338 Bacteria 2452
18 Ga0070669_100045605 3300005353 Unclassified 3195
19 Ga0070675_100018084 3300005354 Bacteria 5609
20 Ga0070675_100160112 3300005354 Unclassified 1935
21 Ga0070679_100114631 3300005530 Bacteria 2681
22 Ga0070684_100080891 3300005535 Bacteria 2874
23 Ga0068853_100019615 3300005539 Bacteria 5611
24 Ga0070664_100012859 3300005564 Bacteria 6809
25 Ga0070664_100014393 3300005564 Bacteria 6450
26 Ga0068857_100062812 3300005577 Bacteria 3302
27 Ga0068856_100009161 3300005614 Bacteria 9624
28 Ga0068864_100098622 3300005618 Unclassified 2588
29 Ga0068861_100167934 3300005719 Unclassified 1816
30 Ga0068860_100010109 3300005843 Bacteria 9348
31 Ga0068862_100002224 3300005844 Bacteria 17382
32 Ga0081539_10000534 3300005985 Bacteria 78990
33 Ga0075366_10022867 3300006195 Bacteria 3640
34 Ga0105247_10001402 3300009101 Bacteria 17485
35 Ga0105237_10048485 3300009545 Bacteria 4270
36 Ga0105249_10028708 3300009553 Bacteria 5021
37 Ga0105249_10037846 3300009553 Bacteria 4378
38 Ga0105239_10006931 3300010375 Bacteria 13070
39 Ga0105239_10072850 3300010375 Bacteria 3777
40 Ga0157370_10000018 3300013104 Bacteria 169223
41 Ga0157370_10022406 3300013104 Bacteria 6286
42 Ga0157370_10035203 3300013104 Bacteria 4870
43 Ga0157374_10036063 3300013296 Bacteria 4528
44 Ga0157374_10062181 3300013296 Bacteria 3498
45 Ga0163162_10004273 3300013306 Bacteria 13742
46 Ga0163162_10006852 3300013306 Bacteria 11056
47 Ga0157372_10035132 3300013307 Bacteria 5515
48 Ga0163163_10000509 3300014325 Bacteria 34781
49 Ga0163163_10010004 3300014325 Bacteria 8504
50 Ga0157380_10072012 3300014326 Bacteria 2798
51 Ga0157377_10003718 3300014745 Bacteria 6925
52 Ga0157377_10045275 3300014745 Bacteria 2457
53 Ga0157379_10126023 3300014968 Bacteria 2304
54 Ga0209646_1000017 3300025246 Bacteria 488265
55 Ga0209026_1000196 3300025250 Bacteria 84284
56 Ga0209673_1001174 3300025273 Bacteria 28377
57 Ga0209564_1002974 3300025295 Bacteria 12183
58 Ga0209758_1008388 3300025297 Bacteria 6710
59 Ga0209758_1032076 3300025297 Bacteria 2141
60 Ga0209050_1001005 3300025298 Bacteria 35385
61 Ga0207426_1000192 3300025302 Bacteria 151680
62 Ga0207426_1000840 3300025302 Bacteria 32431
63 Ga0209257_1002692 3300025304 Bacteria 16997
64 Ga0207710_10000772 3300025900 Bacteria 17434
65 Ga0207671_10079726 3300025914 Bacteria 2454
66 Ga0207657_10006947 3300025919 Bacteria 11664
67 Ga0207650_10004265 3300025925 Bacteria 9757
68 Ga0207650_10094557 3300025925 Bacteria 2290
69 Ga0207644_10116491 3300025931 Bacteria 2028
70 Ga0207690_10025443 3300025932 Bacteria 3717
71 Ga0207706_10035884 3300025933 Bacteria 4406
72 Ga0207712_10067234 3300025961 Bacteria 2564
73 Ga0207658_10061036 3300025986 Bacteria 2816
74 Ga0207639_10035068 3300026041 Bacteria 3712
75 Ga0207641_10126537 3300026088 Bacteria 2288
76 Ga0207676_10035883 3300026095 Unclassified 3768
77 Ga0207698_10050337 3300026142 Bacteria 3177
78 Ga0268265_10027398 3300028380 Bacteria 4067
79 Ga0268264_10007302 3300028381 Bacteria 9242
80 Ga0265323_10000325 3300028653 Bacteria 27336
81 Ga0265327_10000199 3300031251 Bacteria 125838
82 Ga0265316_10003198 3300031344 Bacteria 16644
83 Ga0307509_10079249 3300031507 Bacteria 3401
84 Ga0307405_10000128 3300031731 Bacteria 30132
85 Ga0307406_10025421 3300031901 Bacteria 3546
86 Ga0307414_10029639 3300032004 Bacteria 3564
87 Ga0307414_10037624 3300032004 Bacteria 3242
88 Ga0395898_0145587 3300037466 Bacteria 2268
89 Ga0395905_0007241 3300037471 Bacteria 11054
90 Ga0400489_67845 3300039093 Archaea 6458
91 Ga0439436_0003223 3300041404 Bacteria 4954
92 Ga0466972_0000035 3300044658 Bacteria 147516
93 Ga0466972_0044101 3300044658 Unclassified 2164
94 Ga0453684_0002050 3300044712 Bacteria 51274
95 Ga0466970_0004652 3300044765 Bacteria 6772
96 Ga0466959_0005271 3300045049 Bacteria 8832
97 Ga0495627_009963 3300046453 Bacteria 3475
98 Ga0495607_0031851 3300046501 Bacteria 3225
99 Ga0495606_0022895 3300046507 Bacteria 4540
100 Ga0495643_0000268 3300046522 Bacteria 75600
101 Ga0495668_0001819 3300046616 Bacteria 19357
102 Ga0495625_0035702 3300046660 Bacteria 3661
103 Ga0495686_0011791 3300047472 Bacteria 6151
104 Ga0496115_0010110 3300048918 Bacteria 7038
105 Ga0496125_0000586 3300048928 Bacteria 62077
106 Ga0501034_0000017 3300049571 Bacteria 285938
107 Ga0501034_0002546 3300049571 Bacteria 21767
108 Ga0501034_0098306 3300049571 Bacteria 2922
109 Ga0501043_0005042 3300049579 Bacteria 10681
110 Ga0501047_0015215 3300049581 Bacteria 7327
111 Ga0501073_0047624 3300049589 Bacteria 3012
112 Ga0501080_0028193 3300049742 Bacteria 5221
113 Ga0501044_0013138 3300049823 Bacteria 8964
114 Ga0500644_0003080 3300053088 Bacteria 4132
115 Ga0500641_0000049 3300053096 Bacteria 54582
116 Ga0500562_000017 3300053108 Bacteria 130556
117 Ga0500652_004987 3300053131 Bacteria 4150
118 Ga0500622_0029434 3300053156 Bacteria 2888
119 Ga0500645_014870 3300053730 Bacteria 2475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10048485 Ga0105237_100484853 477
2 3300025925 Ga0207650_10094557 Ga0207650_100945572 479
3 3300053156 Ga0500622_0029434 Ga0500622_0029434_616_2133 496
4 3300009553 Ga0105249_10028708 Ga0105249_100287082 502
5 iso_pu_bacteria 2910245624 2910247143 511
6 3300013307 Ga0157372_10035132 Ga0157372_100351322 512
7 3300005353 Ga0070669_100045605 Ga0070669_1000456052 518
8 3300046616 Ga0495668_0001819 Ga0495668_0001819_6330_7916 518
9 3300049571 Ga0501034_0000017 Ga0501034_0000017_118332_119918 518
10 3300053096 Ga0500641_0000049 Ga0500641_0000049_26801_28357 518
11 3300005843 Ga0068860_100010109 Ga0068860_1000101096 522
12 3300005844 Ga0068862_100002224 Ga0068862_1000022247 522
13 3300025986 Ga0207658_10061036 Ga0207658_100610362 522
14 3300028380 Ga0268265_10027398 Ga0268265_100273982 522
15 3300028381 Ga0268264_10007302 Ga0268264_100073025 522
16 3300039093 Ga0400489_67845 Ga0400489_67845_174_1826 522
17 iso_pu_bacteria 2896085136 2896089635 522
18 iso_pu_bacteria 2896109856 2896110884 522
19 3300046453 Ga0495627_009963 Ga0495627_009963_236_1837 524
20 iso_pu_bacteria 2883068021 2883068619 524
21 3300005329 Ga0070683_100126861 Ga0070683_1001268611 525
22 3300005337 Ga0070682_100090459 Ga0070682_1000904591 525
23 3300005354 Ga0070675_100018084 Ga0070675_1000180842 525
24 3300005530 Ga0070679_100114631 Ga0070679_1001146311 525
25 3300005535 Ga0070684_100080891 Ga0070684_1000808912 525
26 3300005614 Ga0068856_100009161 Ga0068856_1000091612 525
27 3300013104 Ga0157370_10035203 Ga0157370_100352034 525
28 3300013296 Ga0157374_10062181 Ga0157374_100621812 525
29 3300014968 Ga0157379_10126023 Ga0157379_101260231 525
30 3300025919 Ga0207657_10006947 Ga0207657_100069478 525
31 3300025931 Ga0207644_10116491 Ga0207644_101164912 525
32 3300025932 Ga0207690_10025443 Ga0207690_100254432 525
33 3300025933 Ga0207706_10035884 Ga0207706_100358842 525
34 3300031251 Ga0265327_10000199 Ga0265327_1000019954 525
35 iso_pu_bacteria 2818991444 2819588851 525
36 3300002738 JGI25154J39366_1000042 JGI25154J39366_100004247 526
37 3300003203 JGI25406J46586_10001836 JGI25406J46586_1000183610 526
38 3300005329 Ga0070683_100020259 Ga0070683_1000202592 526
39 3300005564 Ga0070664_100014393 Ga0070664_1000143934 526
40 3300005985 Ga0081539_10000534 Ga0081539_1000053421 526
41 3300014325 Ga0163163_10010004 Ga0163163_100100045 526
42 3300014745 Ga0157377_10045275 Ga0157377_100452752 526
43 3300025246 Ga0209646_1000017 Ga0209646_100001790 526
44 3300025250 Ga0209026_1000196 Ga0209026_100019651 526
45 3300025925 Ga0207650_10004265 Ga0207650_100042654 526
46 3300026142 Ga0207698_10050337 Ga0207698_100503372 526
47 3300037471 Ga0395905_0007241 Ga0395905_0007241_8465_10087 526
48 3300053131 Ga0500652_004987 Ga0500652_004987_537_2189 526
49 iso_pu_bacteria 2929921140 2929925427 526
50 iso_pu_bacteria 8003151029 8003155423 526
51 3300002459 JGI24751J29686_10000892 JGI24751J29686_100008922 527
52 3300003320 rootH2_10041581 rootH2_100415811 527
53 3300005331 Ga0070670_100029167 Ga0070670_1000291673 527
54 3300005618 Ga0068864_100098622 Ga0068864_1000986222 527
55 3300009553 Ga0105249_10037846 Ga0105249_100378462 527
56 3300013306 Ga0163162_10004273 Ga0163162_100042739 527
57 3300025961 Ga0207712_10067234 Ga0207712_100672342 527
58 3300026088 Ga0207641_10126537 Ga0207641_101265371 527
59 3300026095 Ga0207676_10035883 Ga0207676_100358832 527
60 3300005327 Ga0070658_10000857 Ga0070658_100008571 528
61 3300006195 Ga0075366_10022867 Ga0075366_100228672 528
62 3300047472 Ga0495686_0011791 Ga0495686_0011791_366_2021 528
63 3300049571 Ga0501034_0002546 Ga0501034_0002546_7411_9039 528
64 3300049579 Ga0501043_0005042 Ga0501043_0005042_1314_2942 528
65 3300049589 Ga0501073_0047624 Ga0501073_0047624_71_1699 528
66 3300049742 Ga0501080_0028193 Ga0501080_0028193_3514_5142 528
67 3300049823 Ga0501044_0013138 Ga0501044_0013138_5821_7449 528
68 iso_pu_bacteria 2884791551 2884793363 528
69 3300001989 JGI24739J22299_10009108 JGI24739J22299_100091083 529
70 3300005330 Ga0070690_100047178 Ga0070690_1000471782 529
71 3300005338 Ga0068868_100091458 Ga0068868_1000914582 529
72 3300005354 Ga0070675_100160112 Ga0070675_1001601122 529
73 3300005539 Ga0068853_100019615 Ga0068853_1000196152 529
74 3300005564 Ga0070664_100012859 Ga0070664_1000128594 529
75 3300005719 Ga0068861_100167934 Ga0068861_1001679341 529
76 3300013296 Ga0157374_10036063 Ga0157374_100360633 529
77 3300014326 Ga0157380_10072012 Ga0157380_100720122 529
78 3300014745 Ga0157377_10003718 Ga0157377_100037182 529
79 3300025297 Ga0209758_1032076 Ga0209758_10320761 529
80 3300026041 Ga0207639_10035068 Ga0207639_100350682 529
81 3300037466 Ga0395898_0145587 Ga0395898_0145587_486_2120 529
82 3300049571 Ga0501034_0098306 Ga0501034_0098306_844_2511 529
83 3300053108 Ga0500562_000017 Ga0500562_000017_33581_35215 529
84 3300053730 Ga0500645_014870 Ga0500645_014870_764_2398 529
85 iso_pu_bacteria 2919509842 2919511897 529
86 iso_pu_bacteria 2958512119 2958515180 529
87 3300041404 Ga0439436_0003223 Ga0439436_0003223_2229_3857 530
88 3300044658 Ga0466972_0044101 Ga0466972_0044101_473_2116 530
89 3300045049 Ga0466959_0005271 Ga0466959_0005271_2728_4371 530
90 3300053088 Ga0500644_0003080 Ga0500644_0003080_2160_3788 530
91 iso_pu_bacteria 2739367866 2740031101 530
92 iso_pu_bacteria 2839989709 2839991203 530
93 3300009101 Ga0105247_10001402 Ga0105247_100014029 531
94 3300025302 Ga0207426_1000192 Ga0207426_100019227 531
95 3300025900 Ga0207710_10000772 Ga0207710_100007729 531
96 3300031507 Ga0307509_10079249 Ga0307509_100792492 531
97 3300032004 Ga0307414_10029639 Ga0307414_100296393 531
98 iso_pu_bacteria 2881247448 2881247816 531
99 iso_pu_bacteria 2929154850 2929157349 531
100 iso_pu_bacteria 8036736890 8036737820 531
101 3300003354 JGI25160J50197_1001063 JGI25160J50197_100106313 532
102 3300003790 Ga0055528_1000317 Ga0055528_100031724 532
103 3300003791 Ga0055530_10001134 Ga0055530_1000113418 532
104 3300010375 Ga0105239_10006931 Ga0105239_100069312 532
105 3300025273 Ga0209673_1001174 Ga0209673_100117417 532
106 3300025295 Ga0209564_1002974 Ga0209564_10029746 532
107 3300025298 Ga0209050_1001005 Ga0209050_100100512 532
108 3300025302 Ga0207426_1000840 Ga0207426_100084027 532
109 3300025304 Ga0209257_1002692 Ga0209257_10026928 532
110 3300025914 Ga0207671_10079726 Ga0207671_100797262 532
111 3300044658 Ga0466972_0000035 Ga0466972_0000035_111795_113516 532
112 3300044765 Ga0466970_0004652 Ga0466970_0004652_3768_5489 532
113 3300049581 Ga0501047_0015215 Ga0501047_0015215_3185_4867 532
114 3300005577 Ga0068857_100062812 Ga0068857_1000628122 533
115 3300010375 Ga0105239_10072850 Ga0105239_100728502 533
116 3300013104 Ga0157370_10000018 Ga0157370_1000001834 533
117 3300013306 Ga0163162_10006852 Ga0163162_100068527 533
118 3300014325 Ga0163163_10000509 Ga0163163_1000050914 533
119 3300025297 Ga0209758_1008388 Ga0209758_10083882 533
120 3300044712 Ga0453684_0002050 Ga0453684_0002050_33514_35157 533
121 3300046501 Ga0495607_0031851 Ga0495607_0031851_476_2077 533
122 3300046507 Ga0495606_0022895 Ga0495606_0022895_1383_2984 533
123 3300048918 Ga0496115_0010110 Ga0496115_0010110_2251_3852 533
124 3300048928 Ga0496125_0000586 Ga0496125_0000586_41285_42886 533
125 3300031344 Ga0265316_10003198 Ga0265316_100031984 534
126 3300032004 Ga0307414_10037624 Ga0307414_100376242 534
127 iso_pu_bacteria 2833640130 2833640521 534
128 3300028653 Ga0265323_10000325 Ga0265323_1000032520 535
129 3300046522 Ga0495643_0000268 Ga0495643_0000268_22379_23986 535
130 3300046660 Ga0495625_0035702 Ga0495625_0035702_905_2512 535
131 2162886007 SwRhRL2b_contig_2499112 SwRhRL2b_0879.00004080 539
132 3300005289 Ga0065704_10076026 Ga0065704_100760262 539
133 3300013104 Ga0157370_10022406 Ga0157370_100224061 539
134 3300031731 Ga0307405_10000128 Ga0307405_100001286 539
135 3300031901 Ga0307406_10025421 Ga0307406_100254212 539

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00496

SBP_bac_5

Bacterial extracellular solute-binding proteins, family 5 Middle

149

538

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4o-assembly1.cif.gz_A-2 a 2.05a x-ray structureof a bacterial extracellular solute-binding protein, family 5 for bacillus anthracis str. ames 0.9283 32 537
5u4o-assembly1.cif.gz_A-2 a 2.05a x-ray structureof a bacterial extracellular solute-binding protein, family 5 for bacillus anthracis str. ames 0.9207 32 537
1uqw-assembly2.cif.gz_B crystal structure of ylib protein from escherichia coi 0.9119 31 537
1uqw-assembly2.cif.gz_B crystal structure of ylib protein from escherichia coi 0.9065 31 537
5isu-assembly1.cif.gz_A 2.2 angstrom crystal structure of abc transporter substrate binding protein ctap (lmo0135) from listeria monocytogenes. 0.8818 32 538
ID Description Score Start End Superfamily
af_P75797_27_224_3.10.105.10 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.9248 31 241 3.10.105.10
af_P76128_273_484_3.10.105.10 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.9128 291 506 3.10.105.10
af_P75797_27_224_3.10.105.10 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.9114 31 241 3.10.105.10
4oetA02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.9106 64 181 3.90.76.10
af_P76128_273_484_3.10.105.10 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.9087 291 506 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A2J6HWF7-F1-model_v4 ABC transporter substrate-binding protein 0.9707 50 538 GO:0015833
GO:0030313
GO:0042597
GO:0043190
GO:1904680
AF-A0A238VYC4-F1-model_v4 Peptide/nickel transport system substrate-binding protein 0.9673 1 537 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A0E9N3G8-F1-model_v4 Putative ABC transporter substrate-binding protein 0.9631 56 539 GO:0015833
GO:0030313
GO:0042597
GO:0043190
GO:1904680
AF-A0A238VYC4-F1-model_v4 Peptide/nickel transport system substrate-binding protein 0.962 1 537 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A662BLN4-F1-model_v4 ABC transporter substrate-binding protein 0.9614 20 505 GO:0015833
GO:0030313
GO:0042597
GO:0043190
GO:1904680

Feature Viewer

pLDDT pTM Quality
90.09 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map