F161279

General Info

Members Datasets Scaffolds Average Seq Length
134 98 268 265

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0231741|Ga0501047_0231741_775_1659
Length 294
Sequence MFYMLNNLDNRDALPQALTMTDDTARSASPQHELARAMEASKAPAISRAAAILRLLGKRDAPLGVQAIARELGLVPSTCLYVLRALVAEELVAFDPDTKRYSLEAGVLTLARQWLRRNPFNELAQPVLDRIAQAFDVTMLGVQIVGLDHIIVVATSQSGPSFQLSTQIGSRFPALISATGRCIAAFGGYPEAELKARFKTLRWDEPPSFEDWKVQVAQTRLHGFAVDEGNYISGVTVAAAPVWKARGRPSHALVAIGIGGAVKRNGLPALQDELKTGAQTLSNQLSGEIAPAWS

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
4 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
6 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
9 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
10 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
18 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
19 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
20 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
25 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
27 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
28 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
29 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
30 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
33 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
34 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
35 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
36 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
37 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
38 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
39 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
40 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
41 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
42 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
43 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
44 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
45 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
46 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
47 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
48 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
49 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
50 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
51 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
52 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
53 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
54 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
55 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
56 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
57 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
58 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
59 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
60 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
61 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
62 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
63 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
64 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
65 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
66 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
67 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
68 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
69 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
70 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
71 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
72 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
73 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
77 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
79 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
80 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
81 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
82 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
83 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
84 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
85 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
86 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
87 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
88 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
89 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
90 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
91 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
92 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
93 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
94 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
95 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
96 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
97 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
98 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.27
Metatranscriptomes 0
Isolates 3.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.9
Nodule 0.75
Rhizoplane 0.75
Rhizosphere 58.21
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0231741 3300049581 Bacteria 1700
2 JGI25165J46597_1000156 3300003214 Bacteria 109696
3 Ga0068860_100422083 3300005843 Bacteria 1322
4 Ga0081539_10031534 3300005985 Bacteria 3264
5 Ga0075368_10001040 3300006042 Bacteria 8693
6 Ga0075363_100003751 3300006048 Bacteria 6540
7 Ga0075367_10011651 3300006178 Bacteria 4664
8 Ga0075366_10074889 3300006195 Bacteria 2019
9 Ga0075370_10072535 3300006353 Bacteria 1971
10 Ga0075430_100057236 3300006846 Bacteria 3279
11 Ga0075431_100129802 3300006847 Unclassified 2600
12 Ga0079104_1004965 3300006946 Bacteria 5472
13 Ga0105240_10017110 3300009093 Bacteria 9789
14 Ga0111539_10402723 3300009094 Bacteria 1594
15 Ga0105237_10003478 3300009545 Bacteria 18674
16 Ga0105239_10012299 3300010375 Bacteria 9532
17 Ga0209437_104852 3300025233 Bacteria 2334
18 Ga0209026_1020537 3300025250 Bacteria 1026
19 Ga0209233_1000213 3300025261 Bacteria 109881
20 Ga0209050_1000426 3300025298 Bacteria 77545
21 Ga0207695_10015402 3300025913 Bacteria 9002
22 Ga0207671_10072633 3300025914 Bacteria 2568
23 Ga0209371_1028901 3300027312 Bacteria 1230
24 Ga0209813_10000031 3300027866 Bacteria 65084
25 Ga0268264_10144489 3300028381 Bacteria 2125
26 Ga0265334_10000075 3300028573 Bacteria 72027
27 Ga0265334_10000787 3300028573 Bacteria 15869
28 Ga0307515_10084611 3300028794 Bacteria 4071
29 Ga0307511_10000581 3300030521 Bacteria 39122
30 Ga0307511_10008856 3300030521 Bacteria 10045
31 Ga0307513_10019069 3300031456 Bacteria 8177
32 Ga0307509_10000224 3300031507 Bacteria 91320
33 Ga0307508_10001759 3300031616 Bacteria 24057
34 Ga0307508_10035175 3300031616 Bacteria 4515
35 Ga0307508_10254186 3300031616 Bacteria 1353
36 Ga0307510_10000001 3300033180 Bacteria 1172244
37 Ga0373936_0088706 3300035113 Unclassified 1295
38 Ga0316574_0068616 3300035398 Bacteria 2236
39 Ga0373935_0349351 3300035692 Bacteria 1054
40 Ga0373937_0195532 3300036401 Bacteria 1901
41 Ga0436365_0665840 3300039437 Bacteria 1090
42 Ga0451841_0951032 3300041498 Bacteria 2177
43 Ga0451845_0781904 3300041501 Bacteria 1334
44 Ga0439446_0051787 3300042156 Bacteria 1227
45 Ga0495603_0177790 3300046455 Bacteria 1232
46 Ga0495629_0070786 3300046459 Bacteria 2434
47 Ga0495638_0000021 3300046460 Bacteria 365602
48 Ga0495638_0000079 3300046460 Bacteria 157488
49 Ga0495638_0005402 3300046460 Bacteria 9516
50 Ga0495638_0005468 3300046460 Bacteria 9448
51 Ga0495638_0034502 3300046460 Bacteria 3230
52 Ga0495638_0061143 3300046460 Bacteria 2328
53 Ga0495638_0107215 3300046460 Bacteria 1664
54 Ga0495596_0000081 3300046500 Bacteria 65577
55 Ga0495596_0000911 3300046500 Bacteria 17653
56 Ga0495607_0119279 3300046501 Bacteria 1387
57 Ga0495583_0000332 3300046506 Bacteria 74708
58 Ga0495583_0037698 3300046506 Bacteria 2290
59 Ga0495610_0000406 3300046512 Bacteria 44173
60 Ga0495610_0002077 3300046512 Bacteria 17092
61 Ga0495630_0060820 3300046517 Bacteria 2836
62 Ga0495632_0000659 3300046519 Bacteria 31636
63 Ga0495632_0057214 3300046519 Bacteria 1904
64 Ga0495643_0000201 3300046522 Bacteria 93295
65 Ga0495643_0007273 3300046522 Bacteria 7157
66 Ga0495643_0152330 3300046522 Bacteria 1144
67 Ga0495648_0000026 3300046524 Bacteria 232162
68 Ga0495586_0248777 3300046535 Bacteria 1014
69 Ga0495609_0009071 3300046538 Bacteria 4833
70 Ga0495622_0063324 3300046557 Bacteria 1711
71 Ga0495633_0014196 3300046558 Bacteria 4174
72 Ga0495633_0025454 3300046558 Bacteria 2913
73 Ga0495611_0056730 3300046648 Bacteria 1774
74 Ga0495625_0000011 3300046660 Bacteria 377120
75 Ga0495625_0000078 3300046660 Bacteria 161613
76 Ga0495625_0008126 3300046660 Bacteria 8994
77 Ga0495625_0013008 3300046660 Bacteria 6712
78 Ga0495625_0026013 3300046660 Bacteria 4427
79 Ga0495625_0033417 3300046660 Bacteria 3804
80 Ga0495658_0190485 3300046683 Bacteria 1275
81 Ga0495670_0038864 3300046691 Bacteria 2373
82 Ga0495670_0074992 3300046691 Bacteria 1717
83 Ga0495671_0000050 3300046692 Bacteria 141936
84 Ga0495671_0062269 3300046692 Bacteria 1839
85 Ga0495581_0189922 3300047315 Bacteria 1201
86 Ga0495680_0041561 3300047322 Bacteria 3656
87 Ga0495673_0000125 3300047469 Bacteria 141937
88 Ga0495686_0085902 3300047472 Bacteria 1915
89 Ga0495615_0000016 3300048090 Bacteria 56891
90 Ga0495626_0017814 3300048091 Bacteria 3581
91 Ga0496101_0151863 3300048904 Bacteria 1772
92 Ga0496116_0000062 3300048919 Bacteria 271104
93 Ga0496118_0051301 3300048921 Bacteria 3157
94 Ga0496121_0005361 3300048924 Bacteria 16487
95 Ga0496122_0011540 3300048925 Bacteria 8933
96 Ga0496122_0016785 3300048925 Bacteria 6896
97 Ga0496123_0000428 3300048926 Bacteria 75893
98 Ga0496123_0001578 3300048926 Bacteria 31096
99 Ga0496124_0001631 3300048927 Bacteria 32175
100 Ga0496124_0003581 3300048927 Bacteria 18878
101 Ga0496125_0019799 3300048928 Bacteria 6332
102 Ga0496126_0000709 3300048929 Bacteria 60772
103 Ga0501047_0084105 3300049581 Bacteria 3058
104 Ga0501047_0091144 3300049581 Bacteria 2926
105 Ga0501047_0832661 3300049581 Unclassified 737
106 Ga0501249_000139 3300049679 Bacteria 22524
107 Ga0501035_0519446 3300049822 Bacteria 978
108 Ga0501044_0000424 3300049823 Bacteria 52233
109 Ga0501044_0060995 3300049823 Bacteria 3859
110 nmdc:mga06z11_81_c1 3300050494 Bacteria 40390
111 nmdc:mga04h51_54_c1 3300050495 Bacteria 36697
112 nmdc:mga07m45_26531_c1 3300050496 Bacteria 3185
113 nmdc:mga0qj67_19184_c1 3300050509 Bacteria 5223
114 nmdc:mga06r32_153611_c1 3300050510 Bacteria 2281
115 Ga0500583_0114957 3300053092 Bacteria 1328
116 Ga0500583_0150610 3300053092 Bacteria 1158
117 Ga0500583_0187776 3300053092 Unclassified 1028
118 Ga0500591_020931 3300053115 Bacteria 3172
119 Ga0500595_034786 3300053119 Bacteria 1664
120 Ga0500614_071394 3300053123 Bacteria 954
121 Ga0500658_0043544 3300053134 Bacteria 1808
122 Ga0500559_0099690 3300053136 Bacteria 1337
123 Ga0500568_0012251 3300053139 Bacteria 3950
124 Ga0500622_0001137 3300053156 Bacteria 22215
125 Ga0500622_0003176 3300053156 Bacteria 11234
126 Ga0500622_0005238 3300053156 Bacteria 7837
127 Ga0500622_0064173 3300053156 Bacteria 1868
128 Ga0500624_000066 3300053157 Bacteria 62660
129 Ga0500639_038909 3300053163 Bacteria 2505
130 2511129682 2510917021 Bacteria 5705459
131 2512646150 2512564014 Bacteria 4639632
132 2819554048 2818991438 Bacteria 5793701
133 2919713017 2919709256 Bacteria 4318106
134 8054303902 8054302542 Bacteria 5698134
135 Ga0501047_0231741
136 JGI25165J46597_1000156
137 Ga0068860_100422083
138 Ga0081539_10031534
139 Ga0075368_10001040
140 Ga0075363_100003751
141 Ga0075367_10011651
142 Ga0075366_10074889
143 Ga0075370_10072535
144 Ga0075430_100057236
145 Ga0075431_100129802
146 Ga0079104_1004965
147 Ga0105240_10017110
148 Ga0111539_10402723
149 Ga0105237_10003478
150 Ga0105239_10012299
151 Ga0209437_104852
152 Ga0209026_1020537
153 Ga0209233_1000213
154 Ga0209050_1000426
155 Ga0207695_10015402
156 Ga0207671_10072633
157 Ga0209371_1028901
158 Ga0209813_10000031
159 Ga0268264_10144489
160 Ga0265334_10000075
161 Ga0265334_10000787
162 Ga0307515_10084611
163 Ga0307511_10000581
164 Ga0307511_10008856
165 Ga0307513_10019069
166 Ga0307509_10000224
167 Ga0307508_10001759
168 Ga0307508_10035175
169 Ga0307508_10254186
170 Ga0307510_10000001
171 Ga0373936_0088706
172 Ga0316574_0068616
173 Ga0373935_0349351
174 Ga0373937_0195532
175 Ga0436365_0665840
176 Ga0451841_0951032
177 Ga0451845_0781904
178 Ga0439446_0051787
179 Ga0495603_0177790
180 Ga0495629_0070786
181 Ga0495638_0000021
182 Ga0495638_0000079
183 Ga0495638_0005402
184 Ga0495638_0005468
185 Ga0495638_0034502
186 Ga0495638_0061143
187 Ga0495638_0107215
188 Ga0495596_0000081
189 Ga0495596_0000911
190 Ga0495607_0119279
191 Ga0495583_0000332
192 Ga0495583_0037698
193 Ga0495610_0000406
194 Ga0495610_0002077
195 Ga0495630_0060820
196 Ga0495632_0000659
197 Ga0495632_0057214
198 Ga0495643_0000201
199 Ga0495643_0007273
200 Ga0495643_0152330
201 Ga0495648_0000026
202 Ga0495586_0248777
203 Ga0495609_0009071
204 Ga0495622_0063324
205 Ga0495633_0014196
206 Ga0495633_0025454
207 Ga0495611_0056730
208 Ga0495625_0000011
209 Ga0495625_0000078
210 Ga0495625_0008126
211 Ga0495625_0013008
212 Ga0495625_0026013
213 Ga0495625_0033417
214 Ga0495658_0190485
215 Ga0495670_0038864
216 Ga0495670_0074992
217 Ga0495671_0000050
218 Ga0495671_0062269
219 Ga0495581_0189922
220 Ga0495680_0041561
221 Ga0495673_0000125
222 Ga0495686_0085902
223 Ga0495615_0000016
224 Ga0495626_0017814
225 Ga0496101_0151863
226 Ga0496116_0000062
227 Ga0496118_0051301
228 Ga0496121_0005361
229 Ga0496122_0011540
230 Ga0496122_0016785
231 Ga0496123_0000428
232 Ga0496123_0001578
233 Ga0496124_0001631
234 Ga0496124_0003581
235 Ga0496125_0019799
236 Ga0496126_0000709
237 Ga0501047_0084105
238 Ga0501047_0091144
239 Ga0501047_0832661
240 Ga0501249_000139
241 Ga0501035_0519446
242 Ga0501044_0000424
243 Ga0501044_0060995
244 nmdc:mga06z11_81_c1
245 nmdc:mga04h51_54_c1
246 nmdc:mga07m45_26531_c1
247 nmdc:mga0qj67_19184_c1
248 nmdc:mga06r32_153611_c1
249 Ga0500583_0114957
250 Ga0500583_0150610
251 Ga0500583_0187776
252 Ga0500591_020931
253 Ga0500595_034786
254 Ga0500614_071394
255 Ga0500658_0043544
256 Ga0500559_0099690
257 Ga0500568_0012251
258 Ga0500622_0001137
259 Ga0500622_0003176
260 Ga0500622_0005238
261 Ga0500622_0064173
262 Ga0500624_000066
263 Ga0500639_038909
264 2511129682
265 2512646150
266 2819554048
267 2919713017
268 8054303902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09339

HTH_IclR

IclR helix-turn-helix domain

45

96

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

50

93

0.95

PF01614

IclR

Bacterial transcriptional regulator

113

283

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.963 14 71
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9532 14 64
4hob-assembly1.cif.gz_A the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9526 14 64
4wcg-assembly1.cif.gz_A the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.9416 14 71
1q1h-assembly1.cif.gz_A an extended winged helix domain in general transcription factor e/iie alpha 0.931 15 63
ID Description Score Start End Superfamily
af_A0A1D6NJX1_369_456_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9661 16 61 1.10.10.10
4wcgB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9628 14 71 1.10.10.10
af_K7LL22_351_440_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.961 16 63 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9568 12 73 1.10.10.10
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9546 12 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3B9TR52-F1-model_v4 IclR-ED domain-containing protein 0.8603 79 253 GO:0003677
GO:0003700
GO:0045892
AF-A0A538EK65-F1-model_v4 IclR family transcriptional regulator 0.8466 77 254 GO:0003677
GO:0003700
GO:0045892
AF-A0A2G9X0P9-F1-model_v4 IclR-ED domain-containing protein 0.8388 78 254 GO:0003677
GO:0003700
GO:0045892
AF-X1EUD4-F1-model_v4 IclR-ED domain-containing protein 0.8361 94 254 GO:0003677
GO:0003700
GO:0045892
AF-A0A1W2ET03-F1-model_v4 Transcriptional regulator 0.8353 87 252 GO:0003677
GO:0003700
GO:0045892

Map