F160685

General Info

Members Datasets Scaffolds Average Seq Length
134 103 135 155

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_1486976|Ga0451807_1486976_10_612
Length 184
Sequence VVPPDVASVEGRAYHDFDATRTAEAGMLRRVRIPSSLWKLTKEVARHVLRRPVVGIAALARTPDGRIVLIRRSDSGKWAMPGGTLEWGETLRSALDRELREETGTRLVSMGEVVGVYSRPDRDPRFHAVTLIVEATVAPPSHPPDNPLEILEVRAFADADLPSVLSHGMTEMLNNARLGQRFWE

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
62 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
74 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
85 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
86 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0
Rhizoplane 3.73
Rhizosphere 84.33
Stem 0
Stem Tuber 0
Unclassified 9.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10151044 3300003320 Bacteria 1492
2 rootH2_10198381 3300003320 Bacteria 3976
3 rootH2_10302033 3300003320 Unclassified 1322
4 rootH1_10041144 3300003316 Bacteria 1369
5 rootH1_10041144 3300003323 Bacteria 6158
6 rootH1_10191042 3300003323 Bacteria 4940
7 Ga0070677_10009141 3300005333 Bacteria 3355
8 Ga0070682_100005869 3300005337 Bacteria 6864
9 Ga0068868_100603924 3300005338 Unclassified 972
10 Ga0070689_100513030 3300005340 Bacteria 1028
11 Ga0070691_10440618 3300005341 Bacteria 742
12 Ga0070675_100410527 3300005354 Unclassified 1209
13 Ga0070675_101140406 3300005354 Bacteria 717
14 Ga0070673_100446177 3300005364 Unclassified 1163
15 Ga0070667_101051261 3300005367 Bacteria 760
16 Ga0070667_101312743 3300005367 Unclassified 678
17 Ga0070701_10206709 3300005438 Bacteria 1163
18 Ga0070701_10309045 3300005438 Unclassified 974
19 Ga0070663_100011930 3300005455 Bacteria 5481
20 Ga0068867_100007217 3300005459 Bacteria 7857
21 Ga0070685_10034204 3300005466 Unclassified 2861
22 Ga0070685_10084018 3300005466 Bacteria 1914
23 Ga0070707_101047375 3300005468 Bacteria 781
24 Ga0070672_100000086 3300005543 Bacteria 44707
25 Ga0070686_100570945 3300005544 Unclassified 887
26 Ga0070693_100222529 3300005547 Bacteria 1237
27 Ga0070704_101137058 3300005549 Unclassified 710
28 Ga0070704_101226887 3300005549 Bacteria 684
29 Ga0068855_101406090 3300005563 Bacteria 719
30 Ga0068857_100285728 3300005577 Bacteria 1518
31 Ga0068859_100645836 3300005617 Bacteria 1150
32 Ga0068861_100000704 3300005719 Bacteria 20008
33 Ga0068861_100450296 3300005719 Bacteria 1153
34 Ga0068870_10176049 3300005840 Unclassified 1280
35 Ga0068863_100198758 3300005841 Bacteria 1928
36 Ga0068862_101727060 3300005844 Unclassified 634
37 Ga0070716_100129645 3300006173 Bacteria 1592
38 Ga0075366_10009237 3300006195 Bacteria 5503
39 Ga0075366_10150123 3300006195 Bacteria 1411
40 Ga0097621_101803395 3300006237 Unclassified 583
41 Ga0068871_100950908 3300006358 Unclassified 798
42 Ga0075430_100043140 3300006846 Bacteria 3812
43 Ga0097620_100645941 3300006931 Bacteria 1150
44 Ga0111539_10002445 3300009094 Bacteria 24692
45 Ga0111539_10898122 3300009094 Bacteria 1030
46 Ga0111539_12815790 3300009094 Bacteria 563
47 Ga0105245_10007764 3300009098 Bacteria 9398
48 Ga0105245_10070860 3300009098 Unclassified 3165
49 Ga0105247_10005501 3300009101 Bacteria 7978
50 Ga0105243_10306622 3300009148 Bacteria 1441
51 Ga0105241_10005025 3300009174 Bacteria 9765
52 Ga0105249_10118417 3300009553 Unclassified 2513
53 Ga0105239_11057232 3300010375 Unclassified 934
54 Ga0163163_10018976 3300014325 Bacteria 6451
55 Ga0207682_10037775 3300025893 Bacteria 1957
56 Ga0207710_10012110 3300025900 Bacteria 3624
57 Ga0207654_10005414 3300025911 Bacteria 6455
58 Ga0207652_10641150 3300025921 Bacteria 950
59 Ga0207650_10224062 3300025925 Bacteria 1514
60 Ga0207687_10140191 3300025927 Bacteria 1833
61 Ga0207709_11255320 3300025935 Bacteria 611
62 Ga0207661_10508424 3300025944 Bacteria 1101
63 Ga0207679_11109903 3300025945 Unclassified 726
64 Ga0207667_10000744 3300025949 Bacteria 42375
65 Ga0207712_10070206 3300025961 Unclassified 2516
66 Ga0207658_10799543 3300025986 Bacteria 856
67 Ga0207658_11219000 3300025986 Unclassified 688
68 Ga0207677_10527929 3300026023 Unclassified 1025
69 Ga0207678_10051201 3300026067 Unclassified 3565
70 Ga0207702_10039344 3300026078 Bacteria 3961
71 Ga0207702_10079556 3300026078 Unclassified 2841
72 Ga0207641_10132242 3300026088 Bacteria 2242
73 Ga0207648_10034172 3300026089 Bacteria 4483
74 Ga0207648_11178094 3300026089 Bacteria 719
75 Ga0207675_100001603 3300026118 Bacteria 22676
76 Ga0207428_10051111 3300027907 Bacteria 3304
77 Ga0268265_10275567 3300028380 Unclassified 1503
78 Ga0265337_1004715 3300028556 Bacteria 5602
79 Ga0265326_10002824 3300028558 Bacteria 5805
80 Ga0265334_10002754 3300028573 Bacteria 8120
81 Ga0265318_10078897 3300028577 Unclassified 1217
82 Ga0307515_10513348 3300028794 Unclassified 808
83 Ga0265338_10208651 3300028800 Bacteria 1468
84 Ga0265332_10012495 3300031238 Bacteria 3768
85 Ga0265332_10249070 3300031238 Bacteria 735
86 Ga0265332_10451418 3300031238 Unclassified 532
87 Ga0265340_10002413 3300031247 Bacteria 10634
88 Ga0265339_10000200 3300031249 Bacteria 49204
89 Ga0265331_10073849 3300031250 Bacteria 1592
90 Ga0265316_10000279 3300031344 Bacteria 57458
91 Ga0307513_10115283 3300031456 Unclassified 2669
92 Ga0307513_10489298 3300031456 Bacteria 949
93 Ga0307514_10225272 3300031649 Bacteria 1144
94 Ga0316579_10141792 3300031691 Bacteria 1159
95 Ga0265314_10000001 3300031711 Bacteria 3792860
96 Ga0265314_10019125 3300031711 Bacteria 5314
97 Ga0265342_10088617 3300031712 Unclassified 1777
98 Ga0316576_10015606 3300031727 Bacteria 5103
99 Ga0316576_10109474 3300031727 Bacteria 2070
100 Ga0316576_10123674 3300031727 Unclassified 1944
101 Ga0316578_10052024 3300031728 Unclassified 2399
102 Ga0316578_10641487 3300031728 Unclassified 620
103 Ga0307415_100240138 3300032126 Bacteria 1465
104 Ga0373956_0471988 3300035119 Bacteria 599
105 Ga0373955_0893114 3300035172 Unclassified 547
106 Ga0316584_0315245 3300036712 Unclassified 1130
107 Ga0373925_0521640 3300037068 Unclassified 976
108 Ga0451791_1772007 3300041451 Bacteria 1328
109 Ga0451793_0190114 3300041452 Unclassified 1616
110 Ga0451795_0830608 3300041456 Bacteria 1041
111 Ga0451807_1486976 3300041486 Bacteria 764
112 Ga0451807_2094964 3300041486 Unclassified 1921
113 Ga0451851_0237153 3300041507 Bacteria 1205
114 Ga0451851_0721420 3300041507 Unclassified 1564
115 Ga0451853_1989784 3300041512 Bacteria 10450
116 Ga0495629_0488068 3300046459 Bacteria 832
117 Ga0496119_0169410 3300048922 Bacteria 1154
118 Ga0501042_0686776 3300049578 Bacteria 744
119 Ga0501047_1332535 3300049581 Bacteria 532
120 Ga0501067_0064313 3300049583 Unclassified 2031
121 Ga0501073_0143709 3300049589 Bacteria 1653
122 Ga0501073_0611741 3300049589 Unclassified 752
123 Ga0501074_0341650 3300049590 Bacteria 1063
124 Ga0501076_0271070 3300049592 Unclassified 1390
125 Ga0501077_0170635 3300049593 Unclassified 1382
126 Ga0501083_0008782 3300049744 Bacteria 7132
127 Ga0501083_0070242 3300049744 Bacteria 2329
128 nmdc:mga08y16_1677830_c1 3300050511 Bacteria 591
129 nmdc:mga08y16_7735_c1 3300050511 Bacteria 11258
130 Ga0500635_0069916 3300053080 Unclassified 1243
131 Ga0501084_0001086 3300054114 Bacteria 21146
132 Ga0501084_0201647 3300054114 Bacteria 1678
133 Ga0501084_0261409 3300054114 Unclassified 1461
134 Ga0501082_0077339 3300060353 Unclassified 2869
135 Ga0501082_0849634 3300060353 Unclassified 798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005544 Ga0070686_100570945 Ga0070686_1005709451 137
2 3300009094 Ga0111539_12815790 Ga0111539_128157901 147
3 3300049581 Ga0501047_1332535 Ga0501047_1332535_10_495 147
4 3300050511 nmdc:mga08y16_1677830_c1 nmdc:mga08y16_1677830_c1_25_468 147
5 3300005354 Ga0070675_100410527 Ga0070675_1004105272 148
6 3300005364 Ga0070673_100446177 Ga0070673_1004461772 148
7 3300005543 Ga0070672_100000086 Ga0070672_1000000867 148
8 3300005719 Ga0068861_100000704 Ga0068861_1000007048 148
9 3300005844 Ga0068862_101727060 Ga0068862_1017270601 148
10 3300006358 Ga0068871_100950908 Ga0068871_1009509082 148
11 3300009553 Ga0105249_10118417 Ga0105249_101184172 148
12 3300025961 Ga0207712_10070206 Ga0207712_100702063 148
13 3300026118 Ga0207675_100001603 Ga0207675_1000016036 148
14 3300028380 Ga0268265_10275567 Ga0268265_102755673 148
15 3300005367 Ga0070667_101051261 Ga0070667_1010512612 152
16 3300005438 Ga0070701_10206709 Ga0070701_102067092 152
17 3300005466 Ga0070685_10084018 Ga0070685_100840183 152
18 3300005617 Ga0068859_100645836 Ga0068859_1006458362 152
19 3300006931 Ga0097620_100645941 Ga0097620_1006459412 152
20 3300025986 Ga0207658_10799543 Ga0207658_107995432 152
21 3300006195 Ga0075366_10150123 Ga0075366_101501233 153
22 3300031727 Ga0316576_10109474 Ga0316576_101094741 153
23 3300049578 Ga0501042_0686776 Ga0501042_0686776_239_700 153
24 3300049590 Ga0501074_0341650 Ga0501074_0341650_281_742 153
25 3300049592 Ga0501076_0271070 Ga0501076_0271070_280_741 153
26 3300005333 Ga0070677_10009141 Ga0070677_100091412 154
27 3300005354 Ga0070675_101140406 Ga0070675_1011404062 154
28 3300005468 Ga0070707_101047375 Ga0070707_1010473752 154
29 3300005549 Ga0070704_101137058 Ga0070704_1011370581 154
30 3300005563 Ga0068855_101406090 Ga0068855_1014060901 154
31 3300005841 Ga0068863_100198758 Ga0068863_1001987582 154
32 3300006173 Ga0070716_100129645 Ga0070716_1001296453 154
33 3300006195 Ga0075366_10009237 Ga0075366_100092372 154
34 3300006846 Ga0075430_100043140 Ga0075430_1000431402 154
35 3300010375 Ga0105239_11057232 Ga0105239_110572322 154
36 3300025893 Ga0207682_10037775 Ga0207682_100377753 154
37 3300025925 Ga0207650_10224062 Ga0207650_102240622 154
38 3300025944 Ga0207661_10508424 Ga0207661_105084242 154
39 3300026078 Ga0207702_10039344 Ga0207702_100393444 154
40 3300026088 Ga0207641_10132242 Ga0207641_101322422 154
41 3300028558 Ga0265326_10002824 Ga0265326_100028243 154
42 3300028573 Ga0265334_10002754 Ga0265334_100027548 154
43 3300028577 Ga0265318_10078897 Ga0265318_100788971 154
44 3300028800 Ga0265338_10208651 Ga0265338_102086512 154
45 3300031238 Ga0265332_10012495 Ga0265332_100124956 154
46 3300031238 Ga0265332_10249070 Ga0265332_102490702 154
47 3300031238 Ga0265332_10451418 Ga0265332_104514181 154
48 3300031247 Ga0265340_10002413 Ga0265340_100024139 154
49 3300031249 Ga0265339_10000200 Ga0265339_1000020024 154
50 3300031250 Ga0265331_10073849 Ga0265331_100738492 154
51 3300031344 Ga0265316_10000279 Ga0265316_1000027920 154
52 3300031691 Ga0316579_10141792 Ga0316579_101417921 154
53 3300031711 Ga0265314_10000001 Ga0265314_100000011589 154
54 3300031712 Ga0265342_10088617 Ga0265342_100886172 154
55 3300031727 Ga0316576_10015606 Ga0316576_100156067 154
56 3300031727 Ga0316576_10123674 Ga0316576_101236742 154
57 3300031728 Ga0316578_10052024 Ga0316578_100520243 154
58 3300035172 Ga0373955_0893114 Ga0373955_0893114_25_489 154
59 3300036712 Ga0316584_0315245 Ga0316584_0315245_94_558 154
60 3300037068 Ga0373925_0521640 Ga0373925_0521640_94_558 154
61 3300041451 Ga0451791_1772007 Ga0451791_1772007_632_1096 154
62 3300041452 Ga0451793_0190114 Ga0451793_0190114_266_730 154
63 3300041456 Ga0451795_0830608 Ga0451795_0830608_409_873 154
64 3300041486 Ga0451807_2094964 Ga0451807_2094964_35_499 154
65 3300046459 Ga0495629_0488068 Ga0495629_0488068_307_771 154
66 3300049589 Ga0501073_0143709 Ga0501073_0143709_797_1261 154
67 3300049589 Ga0501073_0611741 Ga0501073_0611741_246_710 154
68 3300049593 Ga0501077_0170635 Ga0501077_0170635_786_1262 154
69 3300049744 Ga0501083_0008782 Ga0501083_0008782_1104_1568 154
70 3300049744 Ga0501083_0070242 Ga0501083_0070242_31_495 154
71 3300054114 Ga0501084_0001086 Ga0501084_0001086_16008_16472 154
72 3300054114 Ga0501084_0201647 Ga0501084_0201647_31_495 154
73 3300060353 Ga0501082_0077339 Ga0501082_0077339_567_1031 154
74 3300060353 Ga0501082_0849634 Ga0501082_0849634_58_522 154
75 3300005549 Ga0070704_101226887 Ga0070704_1012268871 155
76 3300009094 Ga0111539_10002445 Ga0111539_1000244512 155
77 3300027907 Ga0207428_10051111 Ga0207428_100511114 155
78 3300050511 nmdc:mga08y16_7735_c1 nmdc:mga08y16_7735_c1_8589_9056 155
79 3300005577 Ga0068857_100285728 Ga0068857_1002857282 157
80 3300025921 Ga0207652_10641150 Ga0207652_106411502 157
81 3300031649 Ga0307514_10225272 Ga0307514_102252722 157
82 3300041507 Ga0451851_0237153 Ga0451851_0237153_446_919 157
83 3300041512 Ga0451853_1989784 Ga0451853_1989784_7560_8033 157
84 3300049583 Ga0501067_0064313 Ga0501067_0064313_1056_1529 157
85 3300003320 rootH2_10151044 rootH2_101510442 158
86 3300003320 rootH2_10198381 rootH2_101983812 158
87 3300003320 rootH2_10302033 rootH2_103020332 158
88 3300003323 rootH1_10041144 rootH1_100411442 158
89 3300003323 rootH1_10191042 rootH1_101910422 158
90 3300005337 Ga0070682_100005869 Ga0070682_1000058693 158
91 3300005338 Ga0068868_100603924 Ga0068868_1006039242 158
92 3300005340 Ga0070689_100513030 Ga0070689_1005130302 158
93 3300005341 Ga0070691_10440618 Ga0070691_104406181 158
94 3300005367 Ga0070667_101312743 Ga0070667_1013127432 158
95 3300005438 Ga0070701_10309045 Ga0070701_103090451 158
96 3300005455 Ga0070663_100011930 Ga0070663_1000119304 158
97 3300005459 Ga0068867_100007217 Ga0068867_1000072175 158
98 3300005466 Ga0070685_10034204 Ga0070685_100342043 158
99 3300005547 Ga0070693_100222529 Ga0070693_1002225292 158
100 3300005719 Ga0068861_100450296 Ga0068861_1004502962 158
101 3300005840 Ga0068870_10176049 Ga0068870_101760492 158
102 3300006237 Ga0097621_101803395 Ga0097621_1018033951 158
103 3300009094 Ga0111539_10898122 Ga0111539_108981222 158
104 3300009098 Ga0105245_10007764 Ga0105245_100077642 158
105 3300009098 Ga0105245_10070860 Ga0105245_100708602 158
106 3300009101 Ga0105247_10005501 Ga0105247_100055017 158
107 3300009148 Ga0105243_10306622 Ga0105243_103066222 158
108 3300009174 Ga0105241_10005025 Ga0105241_100050254 158
109 3300014325 Ga0163163_10018976 Ga0163163_100189766 158
110 3300025900 Ga0207710_10012110 Ga0207710_100121102 158
111 3300025911 Ga0207654_10005414 Ga0207654_100054144 158
112 3300025927 Ga0207687_10140191 Ga0207687_101401912 158
113 3300025935 Ga0207709_11255320 Ga0207709_112553202 158
114 3300025945 Ga0207679_11109903 Ga0207679_111099032 158
115 3300025949 Ga0207667_10000744 Ga0207667_100007442 158
116 3300025986 Ga0207658_11219000 Ga0207658_112190001 158
117 3300026023 Ga0207677_10527929 Ga0207677_105279291 158
118 3300026067 Ga0207678_10051201 Ga0207678_100512014 158
119 3300026078 Ga0207702_10079556 Ga0207702_100795562 158
120 3300026089 Ga0207648_10034172 Ga0207648_100341724 158
121 3300026089 Ga0207648_11178094 Ga0207648_111780941 158
122 3300028556 Ga0265337_1004715 Ga0265337_10047156 158
123 3300028794 Ga0307515_10513348 Ga0307515_105133482 158
124 3300031456 Ga0307513_10115283 Ga0307513_101152832 158
125 3300031456 Ga0307513_10489298 Ga0307513_104892982 158
126 3300031711 Ga0265314_10019125 Ga0265314_100191252 158
127 3300031728 Ga0316578_10641487 Ga0316578_106414871 158
128 3300032126 Ga0307415_100240138 Ga0307415_1002401381 158
129 3300035119 Ga0373956_0471988 Ga0373956_0471988_55_543 158
130 3300041486 Ga0451807_1486976 Ga0451807_1486976_10_612 158
131 3300041507 Ga0451851_0721420 Ga0451851_0721420_206_682 158
132 3300048922 Ga0496119_0169410 Ga0496119_0169410_518_1003 158
133 3300053080 Ga0500635_0069916 Ga0500635_0069916_517_993 158
134 3300054114 Ga0501084_0261409 Ga0501084_0261409_387_863 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

49

175

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5isy-assembly1.cif.gz_A crystal structure of nudix family protein with nad 0.8704 25 136
2yyh-assembly1.cif.gz_B crystal structure of nudix family protein from aquifex aeolicus 0.8696 25 153
5ggc-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with phosphate and magnesium ions (excess magnesium, i) 0.8574 25 131
4kyx-assembly1.cif.gz_B crystal structure of adp-ribose pyrophosphatase mutt from rickettsia felis 0.8493 24 150
4kyx-assembly1.cif.gz_A crystal structure of adp-ribose pyrophosphatase mutt from rickettsia felis 0.8362 24 150
ID Description Score Start End Superfamily
af_P9WIX5_169_312_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8627 25 133 3.90.79.10
4kyxB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8493 24 150 3.90.79.10
4dywB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8167 25 150 3.90.79.10
2q9pA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8125 26 133 3.90.79.10
5wwdA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8096 25 150 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A830ZY95-F1-model_v4 Mutator MutT homolog 0.9614 31 158 GO:0016787
AF-A0A3N5IUB1-F1-model_v4 deleted 0.9525 24 158
AF-A0A830ZY95-F1-model_v4 Mutator MutT homolog 0.9469 31 158 GO:0016787
AF-A0A6M0BLW3-F1-model_v4 NUDIX hydrolase 0.933 43 158 GO:0016787
AF-A0A6M0BLW3-F1-model_v4 NUDIX hydrolase 0.9254 43 158 GO:0016787

Feature Viewer

pLDDT pTM Quality
86.78 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map