F160415

General Info

Members Datasets Scaffolds Average Seq Length
134 116 268 210

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10044803|Ga0307406_100448033
Length 224
Sequence MSNETVLYDYWRSSASYRVRIALNSLGIAYRTVPVDLLDGEHKAATHLRRNPQGLVPALEIDGLMMTQSLAIIEYLAETRGGSGLLPEDAPGRQRVRALAYAIAMDIHPICNLGVVGHVMELTAGDDVARRAWMRKFIGEGLLAVDRMLDDPRTGVFCHGDSPTMADMCLVPQVYNAERWGVDLSALGRVRRVVDLCNERTAFRDGHPDRVKLQSARDVPFCGE

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
11 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
13 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
14 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
15 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
16 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
17 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
18 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
24 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
25 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
26 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
27 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
28 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
29 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
30 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
31 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
32 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
33 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
34 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
35 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
36 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
37 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
38 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
39 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
40 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
41 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
42 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
43 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
44 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
45 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
46 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
47 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
48 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
49 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
50 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
51 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
54 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
55 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
56 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
57 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
60 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
61 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
62 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
63 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
64 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
65 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
68 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
69 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
70 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
71 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
72 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
74 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
75 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
76 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
77 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
78 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
79 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
84 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
85 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
86 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
87 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
88 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
89 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
90 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
91 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
92 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
93 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
94 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
95 2643221618 Ensifer sp. Root231 Isolate Unclassified
96 2643221626 Ensifer sp. Root31 Isolate Unclassified
97 2643221655 Ensifer sp. Root1252 Isolate Unclassified
98 2643221659 Ensifer sp. Root127 Isolate Unclassified
99 2643221698 Ensifer sp. Root142 Isolate Unclassified
100 2643221712 Ensifer sp. Root258 Isolate Unclassified
101 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
102 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
103 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
104 2844163670 Ensifer sp. 1H6 Isolate Unclassified
105 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
106 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
107 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
108 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
109 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
110 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
111 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
112 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
113 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
114 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
115 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
116 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.85
Metatranscriptomes 0
Isolates 20.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.72
Nodule 9.7
Rhizoplane 0.75
Rhizosphere 60.45
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10044803 3300031901 Bacteria 2774
2 rootL2_10070850 3300003322 Bacteria 1555
3 Ga0070658_10053785 3300005327 Bacteria 3268
4 Ga0070680_100414533 3300005336 Bacteria 1149
5 Ga0070669_100031756 3300005353 Bacteria 3814
6 Ga0070674_101084922 3300005356 Bacteria 706
7 Ga0070679_100141423 3300005530 Bacteria 2386
8 Ga0068854_100013861 3300005578 Bacteria 5301
9 Ga0068854_100175252 3300005578 Bacteria 1671
10 Ga0068852_100527278 3300005616 Bacteria 1179
11 Ga0070717_10181472 3300006028 Bacteria 1835
12 Ga0114129_10507985 3300009147 Bacteria 1573
13 Ga0157375_11335006 3300013308 Bacteria 844
14 Ga0157380_10149370 3300014326 Bacteria 2018
15 Ga0182005_1090650 3300015265 Bacteria 850
16 Ga0214542_1000011 3300021321 Bacteria 238260
17 Ga0214543_1000004 3300021327 Bacteria 527190
18 Ga0213872_10001579 3300021361 Bacteria 14522
19 Ga0213872_10002202 3300021361 Bacteria 11689
20 Ga0207662_10175688 3300025918 Bacteria 1376
21 Ga0207657_10092005 3300025919 Bacteria 2528
22 Ga0207690_10213408 3300025932 Bacteria 1473
23 Ga0207669_10958393 3300025937 Bacteria 717
24 Ga0207640_10044095 3300025981 Bacteria 2855
25 Ga0307517_10053442 3300028786 Bacteria 4022
26 Ga0307517_10069288 3300028786 Bacteria 3199
27 Ga0307515_10019793 3300028794 Bacteria 12076
28 Ga0307515_10027226 3300028794 Bacteria 9785
29 Ga0307408_100110533 3300031548 Bacteria 2110
30 Ga0307405_10070995 3300031731 Bacteria 2239
31 Ga0307413_10072694 3300031824 Bacteria 2171
32 Ga0307410_10142564 3300031852 Bacteria 1774
33 Ga0307410_10203330 3300031852 Bacteria 1513
34 Ga0307406_10080191 3300031901 Bacteria 2166
35 Ga0307407_10059611 3300031903 Bacteria 2223
36 Ga0307407_10081344 3300031903 Bacteria 1960
37 Ga0307412_10088512 3300031911 Bacteria 2160
38 Ga0307412_10424906 3300031911 Bacteria 1088
39 Ga0307409_100008619 3300031995 Bacteria 6201
40 Ga0307416_100119144 3300032002 Bacteria 2347
41 Ga0307416_100596349 3300032002 Bacteria 1184
42 Ga0307414_10278607 3300032004 Bacteria 1404
43 Ga0307414_10318833 3300032004 Bacteria 1322
44 Ga0307411_10159209 3300032005 Bacteria 1688
45 Ga0307415_100048164 3300032126 Bacteria 2874
46 Ga0307510_10001795 3300033180 Bacteria 23961
47 Ga0436365_1845469 3300039437 Bacteria 3003
48 Ga0436360_0052123 3300039438 Bacteria 3137
49 Ga0436361_0053591 3300039447 Bacteria 55790
50 Ga0436361_0259156 3300039447 Bacteria 13506
51 Ga0436361_0464668 3300039447 Bacteria 18222
52 Ga0439436_0023667 3300041404 Bacteria 1816
53 Ga0439438_017863 3300041405 Bacteria 2031
54 Ga0439439_0015726 3300041406 Bacteria 1849
55 Ga0439447_036442 3300041407 Bacteria 1215
56 Ga0451833_0730346 3300041491 Bacteria 22857
57 Ga0451835_0329284 3300041492 Bacteria 5229
58 Ga0451837_0704286 3300041494 Bacteria 4856
59 Ga0451839_1612212 3300041496 Bacteria 11337
60 Ga0451841_1165472 3300041498 Bacteria 3993
61 Ga0451847_0962881 3300041503 Bacteria 3127
62 Ga0451851_1234574 3300041507 Bacteria 29239
63 Ga0451843_0215246 3300041509 Bacteria 22950
64 Ga0451853_2059114 3300041512 Bacteria 14978
65 Ga0439462_0010173 3300042015 Bacteria 2382
66 Ga0450920_021676 3300042122 Bacteria 1243
67 Ga0450906_003564 3300042145 Bacteria 3341
68 Ga0439434_0023538 3300042435 Bacteria 1856
69 Ga0466963_0027436 3300044694 Bacteria 3646
70 Ga0466967_0061782 3300045976 Bacteria 3324
71 Ga0495590_0119708 3300046457 Bacteria 943
72 Ga0495638_0005945 3300046460 Bacteria 8956
73 Ga0495638_0126375 3300046460 Bacteria 1506
74 Ga0495583_0007901 3300046506 Bacteria 6597
75 Ga0495648_0125030 3300046524 Bacteria 1376
76 Ga0495663_0002526 3300046525 Bacteria 5482
77 Ga0495633_0033724 3300046558 Bacteria 2467
78 Ga0495668_0004619 3300046616 Bacteria 9680
79 Ga0495625_0001029 3300046660 Bacteria 36704
80 Ga0495625_0006648 3300046660 Bacteria 10259
81 Ga0495613_0017681 3300046689 Bacteria 5312
82 Ga0495660_0298018 3300046810 Bacteria 732
83 Ga0495672_0087632 3300047320 Bacteria 1718
84 Ga0495687_000093 3300047443 Bacteria 138076
85 Ga0495677_0001726 3300047445 Bacteria 8774
86 Ga0495686_0000208 3300047472 Bacteria 109513
87 Ga0496109_0657318 3300048912 Unclassified 985
88 Ga0496116_0054264 3300048919 Bacteria 2642
89 Ga0496121_0001339 3300048924 Bacteria 42173
90 Ga0496121_0271214 3300048924 Bacteria 1166
91 Ga0496124_0052384 3300048927 Bacteria 3467
92 Ga0496126_0112952 3300048929 Bacteria 2365
93 Ga0495678_000490 3300049459 Bacteria 39259
94 Ga0495682_0026380 3300049460 Bacteria 2157
95 Ga0501033_0000035 3300049570 Bacteria 150558
96 Ga0501039_0070419 3300049575 Bacteria 2717
97 Ga0501080_0725711 3300049742 Bacteria 875
98 Ga0501035_0122660 3300049822 Bacteria 2270
99 Ga0500643_000288 3300053087 Bacteria 43145
100 Ga0500646_0166602 3300053090 Bacteria 739
101 Ga0500556_0157150 3300053104 Bacteria 897
102 Ga0500568_0000042 3300053139 Bacteria 127026
103 Ga0500574_000004 3300053141 Bacteria 79976
104 Ga0500616_0000222 3300053153 Bacteria 88791
105 Ga0500616_0155992 3300053153 Bacteria 1051
106 Ga0500638_000058 3300053162 Bacteria 21331
107 Ga0500645_009302 3300053730 Bacteria 3306
108 2513998046 2513237159 Bacteria 6810126
109 2514001344 2513237159 Bacteria 6810126
110 2515632522 2515154113 Bacteria 7807172
111 2558864547 2558860100 Bacteria 8458965
112 2644106664 2643221618 Bacteria 7717186
113 2644149637 2643221626 Bacteria 8069654
114 2644309738 2643221655 Bacteria 7722067
115 2644333409 2643221659 Bacteria 7890716
116 2644543593 2643221698 Bacteria 7756764
117 2644618185 2643221712 Bacteria 7729434
118 2792641501 2791355094 Bacteria 7011481
119 2842523151 2842521101 Bacteria 6569494
120 2842527032 2842521101 Bacteria 6569494
121 2844008726 2844002411 Bacteria 7168230
122 2844167622 2844163670 Bacteria 7266046
123 2878745868 2878738818 Bacteria 7136951
124 2898795386 2898795034 Bacteria 4294459
125 2899260291 2899259804 Bacteria 3320927
126 2919682579 2919679072 Bacteria 4629602
127 2924784268 2924776078 Bacteria 7492003
128 2941501590 2941499720 Bacteria 7599444
129 2958092856 2958092219 Bacteria 6861151
130 2989773036 2989771324 Bacteria 5605128
131 2995396318 2995392953 Bacteria 4539380
132 3000408001 3000405567 Bacteria 3779330
133 8054303654 8054302542 Bacteria 5698134
134 8056876937 8056875544 Bacteria 4355797
135 Ga0307406_10044803
136 rootL2_10070850
137 Ga0070658_10053785
138 Ga0070680_100414533
139 Ga0070669_100031756
140 Ga0070674_101084922
141 Ga0070679_100141423
142 Ga0068854_100013861
143 Ga0068854_100175252
144 Ga0068852_100527278
145 Ga0070717_10181472
146 Ga0114129_10507985
147 Ga0157375_11335006
148 Ga0157380_10149370
149 Ga0182005_1090650
150 Ga0214542_1000011
151 Ga0214543_1000004
152 Ga0213872_10001579
153 Ga0213872_10002202
154 Ga0207662_10175688
155 Ga0207657_10092005
156 Ga0207690_10213408
157 Ga0207669_10958393
158 Ga0207640_10044095
159 Ga0307517_10053442
160 Ga0307517_10069288
161 Ga0307515_10019793
162 Ga0307515_10027226
163 Ga0307408_100110533
164 Ga0307405_10070995
165 Ga0307413_10072694
166 Ga0307410_10142564
167 Ga0307410_10203330
168 Ga0307406_10080191
169 Ga0307407_10059611
170 Ga0307407_10081344
171 Ga0307412_10088512
172 Ga0307412_10424906
173 Ga0307409_100008619
174 Ga0307416_100119144
175 Ga0307416_100596349
176 Ga0307414_10278607
177 Ga0307414_10318833
178 Ga0307411_10159209
179 Ga0307415_100048164
180 Ga0307510_10001795
181 Ga0436365_1845469
182 Ga0436360_0052123
183 Ga0436361_0053591
184 Ga0436361_0259156
185 Ga0436361_0464668
186 Ga0439436_0023667
187 Ga0439438_017863
188 Ga0439439_0015726
189 Ga0439447_036442
190 Ga0451833_0730346
191 Ga0451835_0329284
192 Ga0451837_0704286
193 Ga0451839_1612212
194 Ga0451841_1165472
195 Ga0451847_0962881
196 Ga0451851_1234574
197 Ga0451843_0215246
198 Ga0451853_2059114
199 Ga0439462_0010173
200 Ga0450920_021676
201 Ga0450906_003564
202 Ga0439434_0023538
203 Ga0466963_0027436
204 Ga0466967_0061782
205 Ga0495590_0119708
206 Ga0495638_0005945
207 Ga0495638_0126375
208 Ga0495583_0007901
209 Ga0495648_0125030
210 Ga0495663_0002526
211 Ga0495633_0033724
212 Ga0495668_0004619
213 Ga0495625_0001029
214 Ga0495625_0006648
215 Ga0495613_0017681
216 Ga0495660_0298018
217 Ga0495672_0087632
218 Ga0495687_000093
219 Ga0495677_0001726
220 Ga0495686_0000208
221 Ga0496109_0657318
222 Ga0496116_0054264
223 Ga0496121_0001339
224 Ga0496121_0271214
225 Ga0496124_0052384
226 Ga0496126_0112952
227 Ga0495678_000490
228 Ga0495682_0026380
229 Ga0501033_0000035
230 Ga0501039_0070419
231 Ga0501080_0725711
232 Ga0501035_0122660
233 Ga0500643_000288
234 Ga0500646_0166602
235 Ga0500556_0157150
236 Ga0500568_0000042
237 Ga0500574_000004
238 Ga0500616_0000222
239 Ga0500616_0155992
240 Ga0500638_000058
241 Ga0500645_009302
242 2513998046
243 2514001344
244 2515632522
245 2558864547
246 2644106664
247 2644149637
248 2644309738
249 2644333409
250 2644543593
251 2644618185
252 2792641501
253 2842523151
254 2842527032
255 2844008726
256 2844167622
257 2878745868
258 2898795386
259 2899260291
260 2919682579
261 2924784268
262 2941501590
263 2958092856
264 2989773036
265 2995396318
266 3000408001
267 8054303654
268 8056876937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

4

78

0.98

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

12

79

0.95

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

7

84

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cz3-assembly1.cif.gz_A crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) 0.949 3 212
4pxo-assembly1.cif.gz_B crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) 0.9427 5 205
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.94 5 212
1fw1-assembly1.cif.gz_A-2 glutathione transferase zeta/maleylacetoacetate isomerase 0.9333 3 212
3niv-assembly1.cif.gz_B the crystal structure of glutathione s-transferase from legionella pneumophila 0.9324 5 205
ID Description Score Start End Superfamily
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9711 7 80 3.40.30.10
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9706 3 77 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9647 3 78 3.40.30.10
2v6kB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9646 7 78 3.40.30.10
af_A0A1D6HAW8_13_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9632 7 72 3.40.30.10
ID Description Score Start End GO Terms
AF-K0VQW5-F1-model_v4 Maleylacetoacetate isomerase 0.9842 25 205 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-F2A638-F1-model_v4 deleted 0.9839 1 205
AF-A0A857C948-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.9746 2 205 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A1W6CVH0-F1-model_v4 Maleylacetoacetate isomerase 0.9739 3 205 GO:0004497
GO:0005506
GO:0005737
GO:0009072
GO:0016705
GO:0016853
GO:0020037
GO:0051537
AF-A0A6H0ZGJ7-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.9703 2 205 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034

Map