F160320

General Info

Members Datasets Scaffolds Average Seq Length
134 86 134 189

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10000251|Ga0265320_1000025111
Length 207
Sequence VLPRNLELTRQGEENLVVSPPSLQPAVFLDRDGTLNASVIKNGKPYPPSSLEEFVLLPGVAAGCAQLKGAGFHLVVATNQPDVGRGTQTQAAVETMHARLLTLVPQIDLVKVCYHGGTDHGQPCNCRKPKPAMLHSAATHLGLDLTRSWMLGDRWRDIDCGHAAGCRTIFIDHGYDEPLRTPPDFIVTNFSAAVGIILAHHSARPVH

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
40 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
41 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
42 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
43 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
44 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
47 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
59 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
60 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
61 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
62 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
63 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
66 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
81 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.75
Rhizosphere 94.78
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000001 3300000545 Bacteria 91563
2 rootH1_10274996 3300003323 Bacteria 1231
3 Ga0070683_100062500 3300005329 Bacteria 3463
4 Ga0070689_100576485 3300005340 Unclassified 972
5 Ga0070691_10029020 3300005341 Bacteria 2587
6 Ga0070673_100459887 3300005364 Unclassified 1146
7 Ga0070688_100093632 3300005365 Bacteria 1968
8 Ga0070688_100159595 3300005365 Bacteria 1548
9 Ga0070709_10462788 3300005434 Unclassified 957
10 Ga0070711_100066897 3300005439 Bacteria 2519
11 Ga0070705_100340215 3300005440 Bacteria 1090
12 Ga0070694_100228679 3300005444 Bacteria 1398
13 Ga0068867_100463433 3300005459 Unclassified 1082
14 Ga0070704_100031326 3300005549 Bacteria 3576
15 Ga0070704_100322802 3300005549 Bacteria 1294
16 Ga0068855_100082027 3300005563 Bacteria 3738
17 Ga0070664_100000911 3300005564 Bacteria 23054
18 Ga0068857_100018623 3300005577 Bacteria 6093
19 Ga0068856_100534746 3300005614 Unclassified 1193
20 Ga0097621_100290094 3300006237 Unclassified 1442
21 Ga0105240_10058081 3300009093 Unclassified 4830
22 Ga0105242_10992467 3300009176 Bacteria 847
23 Ga0105238_10007987 3300009551 Bacteria 10586
24 Ga0105238_10212795 3300009551 Bacteria 1909
25 Ga0105249_10264419 3300009553 Unclassified 1711
26 Ga0157370_10139500 3300013104 Bacteria 2259
27 Ga0157374_11384875 3300013296 Bacteria 726
28 Ga0157378_10005208 3300013297 Bacteria 11417
29 Ga0163162_10103819 3300013306 Bacteria 2936
30 Ga0163162_10545654 3300013306 Unclassified 1288
31 Ga0157375_10144508 3300013308 Bacteria 2508
32 Ga0157376_10136483 3300014969 Unclassified 2195
33 Ga0163161_10007050 3300017792 Bacteria 7776
34 Ga0213876_10048939 3300021384 Bacteria 2232
35 Ga0213876_10252564 3300021384 Unclassified 937
36 Ga0207663_10086836 3300025916 Bacteria 2064
37 Ga0207649_10002185 3300025920 Bacteria 11051
38 Ga0207694_10004858 3300025924 Bacteria 10435
39 Ga0207686_10197808 3300025934 Bacteria 1437
40 Ga0207661_10045432 3300025944 Bacteria 3477
41 Ga0207679_10000400 3300025945 Bacteria 31140
42 Ga0207648_10631726 3300026089 Unclassified 989
43 Ga0207674_10006456 3300026116 Bacteria 13785
44 Ga0265337_1010021 3300028556 Bacteria 3343
45 Ga0265337_1029994 3300028556 Bacteria 1622
46 Ga0265326_10063014 3300028558 Bacteria 1048
47 Ga0265326_10126747 3300028558 Bacteria 727
48 Ga0265319_1020184 3300028563 Bacteria 2476
49 Ga0265323_10000013 3300028653 Bacteria 107343
50 Ga0265323_10000242 3300028653 Bacteria 32174
51 Ga0265323_10001522 3300028653 Bacteria 11276
52 Ga0265323_10005385 3300028653 Bacteria 5436
53 Ga0265323_10012403 3300028653 Bacteria 3415
54 Ga0265323_10012687 3300028653 Bacteria 3371
55 Ga0265323_10036109 3300028653 Unclassified 1819
56 Ga0265323_10059485 3300028653 Unclassified 1332
57 Ga0265322_10004125 3300028654 Bacteria 4342
58 Ga0265336_10042550 3300028666 Bacteria 1386
59 Ga0265338_10002137 3300028800 Bacteria 30371
60 Ga0265338_10018462 3300028800 Bacteria 7464
61 Ga0265338_10022764 3300028800 Bacteria 6470
62 Ga0265338_10076019 3300028800 Bacteria 2847
63 Ga0265338_10256815 3300028800 Bacteria 1287
64 Ga0265338_10375313 3300028800 Unclassified 1018
65 Ga0265324_10001423 3300029957 Bacteria 13746
66 Ga0265324_10022766 3300029957 Bacteria 2238
67 Ga0265324_10041899 3300029957 Bacteria 1583
68 Ga0265324_10103745 3300029957 Unclassified 966
69 Ga0265324_10131794 3300029957 Bacteria 849
70 Ga0265330_10028623 3300031235 Unclassified 2510
71 Ga0265330_10091741 3300031235 Bacteria 1304
72 Ga0265332_10250825 3300031238 Bacteria 732
73 Ga0265320_10000251 3300031240 Bacteria 44069
74 Ga0265320_10009735 3300031240 Bacteria 5767
75 Ga0265320_10015601 3300031240 Unclassified 4289
76 Ga0265320_10081911 3300031240 Bacteria 1505
77 Ga0265320_10092347 3300031240 Unclassified 1401
78 Ga0265325_10017939 3300031241 Bacteria 3929
79 Ga0265339_10010897 3300031249 Bacteria 5620
80 Ga0265339_10225908 3300031249 Bacteria 914
81 Ga0265331_10033004 3300031250 Bacteria 2562
82 Ga0265327_10000063 3300031251 Bacteria 232763
83 Ga0265327_10040464 3300031251 Unclassified 2521
84 Ga0265316_10000485 3300031344 Bacteria 45047
85 Ga0265316_10013629 3300031344 Bacteria 7212
86 Ga0265316_10064505 3300031344 Bacteria 2837
87 Ga0265316_10239136 3300031344 Bacteria 1335
88 Ga0265316_10418189 3300031344 Bacteria 964
89 Ga0265313_10003926 3300031595 Bacteria 11703
90 Ga0265313_10012632 3300031595 Bacteria 5135
91 Ga0265313_10019475 3300031595 Bacteria 3773
92 Ga0265314_10000972 3300031711 Bacteria 33680
93 Ga0265314_10037607 3300031711 Bacteria 3505
94 Ga0265342_10072782 3300031712 Bacteria 2000
95 Ga0265342_10073808 3300031712 Bacteria 1983
96 Ga0373926_0204578 3300035083 Bacteria 760
97 Ga0373928_0000902 3300035084 Bacteria 5814
98 Ga0373929_0001807 3300035085 Bacteria 4008
99 Ga0373944_0000030 3300035089 Bacteria 23893
100 Ga0373951_0005702 3300035091 Bacteria 2882
101 Ga0373932_0000008 3300035112 Bacteria 167879
102 Ga0373943_0097243 3300035170 Bacteria 1534
103 Ga0373946_0034703 3300035171 Bacteria 2038
104 Ga0373946_0237475 3300035171 Bacteria 885
105 Ga0373962_0000016 3300035242 Bacteria 48133
106 Ga0373931_0000011 3300035691 Bacteria 304643
107 Ga0373927_0066115 3300035695 Bacteria 2338
108 Ga0373927_0209743 3300035695 Unclassified 1279
109 Ga0373947_0016509 3300035725 Bacteria 4243
110 Ga0373937_0817730 3300036401 Unclassified 880
111 Ga0373925_0008749 3300037068 Bacteria 7373
112 Ga0436364_0170939 3300037853 Unclassified 663
113 Ga0436365_0181741 3300039437 Bacteria 58736
114 Ga0436365_0548282 3300039437 Unclassified 1016
115 Ga0436362_0434883 3300039453 Bacteria 1456
116 Ga0451577_0005583 3300042876 Bacteria 12808
117 Ga0451577_0040639 3300042876 Bacteria 4175
118 Ga0453684_0000655 3300044712 Bacteria 124610
119 Ga0453684_0216939 3300044712 Bacteria 2219
120 Ga0453684_0284533 3300044712 Bacteria 1884
121 Ga0453684_1711866 3300044712 Bacteria 642
122 Ga0451576_0027913 3300045051 Bacteria 6055
123 Ga0451576_0109686 3300045051 Bacteria 2872
124 Ga0495650_0045413 3300046471 Bacteria 1850
125 Ga0495643_0000140 3300046522 Bacteria 115947
126 Ga0496115_0029984 3300048918 Unclassified 4276
127 Ga0501033_0083532 3300049570 Unclassified 2341
128 Ga0501034_0104496 3300049571 Bacteria 2826
129 Ga0501046_0002376 3300049580 Bacteria 17691
130 Ga0501047_0030338 3300049581 Bacteria 5213
131 Ga0501035_0159218 3300049822 Bacteria 1955
132 Ga0501035_0214900 3300049822 Unclassified 1644
133 Ga0501044_0009413 3300049823 Bacteria 10643
134 Ga0501044_0709495 3300049823 Bacteria 891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0040639 Ga0451577_0040639_3348_3851 163
2 3300044712 Ga0453684_0284533 Ga0453684_0284533_705_1208 163
3 3300045051 Ga0451576_0027913 Ga0451576_0027913_3104_3607 163
4 3300028800 Ga0265338_10375313 Ga0265338_103753131 168
5 3300031240 Ga0265320_10009735 Ga0265320_100097357 168
6 3300005439 Ga0070711_100066897 Ga0070711_1000668973 169
7 3300025916 Ga0207663_10086836 Ga0207663_100868362 169
8 3300025934 Ga0207686_10197808 Ga0207686_101978081 177
9 3300028653 Ga0265323_10059485 Ga0265323_100594852 177
10 3300028800 Ga0265338_10256815 Ga0265338_102568152 177
11 3300029957 Ga0265324_10131794 Ga0265324_101317941 177
12 3300037853 Ga0436364_0170939 Ga0436364_0170939_44_580 177
13 3300003323 rootH1_10274996 rootH1_102749962 178
14 3300005340 Ga0070689_100576485 Ga0070689_1005764851 178
15 3300005563 Ga0068855_100082027 Ga0068855_1000820272 178
16 3300009551 Ga0105238_10007987 Ga0105238_100079874 178
17 3300025924 Ga0207694_10004858 Ga0207694_1000485810 178
18 3300028556 Ga0265337_1010021 Ga0265337_10100212 178
19 3300028558 Ga0265326_10063014 Ga0265326_100630141 178
20 3300028653 Ga0265323_10012403 Ga0265323_100124033 178
21 3300028666 Ga0265336_10042550 Ga0265336_100425502 178
22 3300028800 Ga0265338_10018462 Ga0265338_100184625 178
23 3300031240 Ga0265320_10081911 Ga0265320_100819112 178
24 3300031241 Ga0265325_10017939 Ga0265325_100179393 178
25 3300031249 Ga0265339_10010897 Ga0265339_100108973 178
26 3300031344 Ga0265316_10013629 Ga0265316_100136293 178
27 3300031595 Ga0265313_10019475 Ga0265313_100194754 178
28 3300031711 Ga0265314_10037607 Ga0265314_100376073 178
29 3300031712 Ga0265342_10073808 Ga0265342_100738083 178
30 3300013104 Ga0157370_10139500 Ga0157370_101395002 179
31 3300029957 Ga0265324_10103745 Ga0265324_101037452 179
32 3300005440 Ga0070705_100340215 Ga0070705_1003402152 180
33 3300031251 Ga0265327_10040464 Ga0265327_100404643 180
34 3300036401 Ga0373937_0817730 Ga0373937_0817730_170_718 180
35 3300049570 Ga0501033_0083532 Ga0501033_0083532_1240_1821 180
36 3300049571 Ga0501034_0104496 Ga0501034_0104496_1249_1830 180
37 3300049822 Ga0501035_0214900 Ga0501035_0214900_194_766 180
38 3300049823 Ga0501044_0709495 Ga0501044_0709495_169_741 180
39 3300005549 Ga0070704_100322802 Ga0070704_1003228021 181
40 3300028563 Ga0265319_1020184 Ga0265319_10201843 181
41 3300028653 Ga0265323_10000013 Ga0265323_1000001344 181
42 3300028653 Ga0265323_10005385 Ga0265323_100053854 181
43 3300028653 Ga0265323_10012687 Ga0265323_100126873 181
44 3300031235 Ga0265330_10091741 Ga0265330_100917412 181
45 3300031344 Ga0265316_10000485 Ga0265316_1000048529 181
46 3300044712 Ga0453684_0000655 Ga0453684_0000655_107648_108223 181
47 3300044712 Ga0453684_0216939 Ga0453684_0216939_756_1301 181
48 3300005329 Ga0070683_100062500 Ga0070683_1000625002 182
49 3300005341 Ga0070691_10029020 Ga0070691_100290203 182
50 3300005564 Ga0070664_100000911 Ga0070664_1000009118 182
51 3300005577 Ga0068857_100018623 Ga0068857_1000186232 182
52 3300005614 Ga0068856_100534746 Ga0068856_1005347463 182
53 3300009093 Ga0105240_10058081 Ga0105240_100580813 182
54 3300025920 Ga0207649_10002185 Ga0207649_100021856 182
55 3300025944 Ga0207661_10045432 Ga0207661_100454322 182
56 3300025945 Ga0207679_10000400 Ga0207679_1000040011 182
57 3300026116 Ga0207674_10006456 Ga0207674_100064562 182
58 3300028653 Ga0265323_10001522 Ga0265323_100015229 182
59 3300028800 Ga0265338_10022764 Ga0265338_100227642 182
60 3300031240 Ga0265320_10092347 Ga0265320_100923471 182
61 3300042876 Ga0451577_0005583 Ga0451577_0005583_939_1502 182
62 3300044712 Ga0453684_1711866 Ga0453684_1711866_36_614 182
63 3300045051 Ga0451576_0109686 Ga0451576_0109686_2071_2622 182
64 3300049822 Ga0501035_0159218 Ga0501035_0159218_879_1454 182
65 3300049823 Ga0501044_0009413 Ga0501044_0009413_1991_2566 182
66 3300021384 Ga0213876_10252564 Ga0213876_102525642 183
67 3300028558 Ga0265326_10126747 Ga0265326_101267472 183
68 3300028653 Ga0265323_10000242 Ga0265323_1000024221 183
69 3300028654 Ga0265322_10004125 Ga0265322_100041254 183
70 3300031238 Ga0265332_10250825 Ga0265332_102508251 183
71 3300031251 Ga0265327_10000063 Ga0265327_1000006354 183
72 3300031344 Ga0265316_10064505 Ga0265316_100645054 183
73 3300031595 Ga0265313_10012632 Ga0265313_100126326 183
74 3300031712 Ga0265342_10072782 Ga0265342_100727823 183
75 3300035171 Ga0373946_0237475 Ga0373946_0237475_134_685 183
76 3300035695 Ga0373927_0066115 Ga0373927_0066115_746_1297 183
77 3300039437 Ga0436365_0548282 Ga0436365_0548282_105_665 183
78 3300005365 Ga0070688_100159595 Ga0070688_1001595953 184
79 3300005444 Ga0070694_100228679 Ga0070694_1002286793 184
80 3300005549 Ga0070704_100031326 Ga0070704_1000313264 184
81 3300028800 Ga0265338_10002137 Ga0265338_1000213715 184
82 3300029957 Ga0265324_10022766 Ga0265324_100227662 184
83 3300029957 Ga0265324_10041899 Ga0265324_100418992 184
84 3300031240 Ga0265320_10015601 Ga0265320_100156012 184
85 3300031250 Ga0265331_10033004 Ga0265331_100330043 184
86 3300031595 Ga0265313_10003926 Ga0265313_100039266 184
87 3300031711 Ga0265314_10000972 Ga0265314_100009725 184
88 3300035083 Ga0373926_0204578 Ga0373926_0204578_153_737 184
89 3300035084 Ga0373928_0000902 Ga0373928_0000902_3938_4522 184
90 3300035085 Ga0373929_0001807 Ga0373929_0001807_1190_1774 184
91 3300035089 Ga0373944_0000030 Ga0373944_0000030_20109_20693 184
92 3300035091 Ga0373951_0005702 Ga0373951_0005702_1425_2009 184
93 3300035112 Ga0373932_0000008 Ga0373932_0000008_151616_152200 184
94 3300035170 Ga0373943_0097243 Ga0373943_0097243_303_887 184
95 3300035171 Ga0373946_0034703 Ga0373946_0034703_991_1575 184
96 3300035242 Ga0373962_0000016 Ga0373962_0000016_40382_40966 184
97 3300035691 Ga0373931_0000011 Ga0373931_0000011_286835_287419 184
98 3300035695 Ga0373927_0209743 Ga0373927_0209743_89_673 184
99 3300035725 Ga0373947_0016509 Ga0373947_0016509_951_1535 184
100 3300037068 Ga0373925_0008749 Ga0373925_0008749_5980_6564 184
101 3300046471 Ga0495650_0045413 Ga0495650_0045413_72_638 184
102 3300048918 Ga0496115_0029984 Ga0496115_0029984_51_635 184
103 3300005459 Ga0068867_100463433 Ga0068867_1004634332 185
104 3300009551 Ga0105238_10212795 Ga0105238_102127952 185
105 3300013296 Ga0157374_11384875 Ga0157374_113848752 185
106 3300013297 Ga0157378_10005208 Ga0157378_100052085 185
107 3300013306 Ga0163162_10545654 Ga0163162_105456542 185
108 3300017792 Ga0163161_10007050 Ga0163161_100070508 185
109 3300026089 Ga0207648_10631726 Ga0207648_106317262 185
110 3300028556 Ga0265337_1029994 Ga0265337_10299943 185
111 3300028653 Ga0265323_10036109 Ga0265323_100361092 185
112 3300029957 Ga0265324_10001423 Ga0265324_1000142315 185
113 3300031235 Ga0265330_10028623 Ga0265330_100286233 185
114 3300031344 Ga0265316_10239136 Ga0265316_102391362 185
115 3300031344 Ga0265316_10418189 Ga0265316_104181892 185
116 3300046522 Ga0495643_0000140 Ga0495643_0000140_8192_8764 185
117 3300005434 Ga0070709_10462788 Ga0070709_104627882 186
118 3300021384 Ga0213876_10048939 Ga0213876_100489393 186
119 3300028800 Ga0265338_10076019 Ga0265338_100760192 186
120 3300039437 Ga0436365_0181741 Ga0436365_0181741_56695_57270 186
121 3300039453 Ga0436362_0434883 Ga0436362_0434883_585_1169 186
122 3300049580 Ga0501046_0002376 Ga0501046_0002376_9419_10027 186
123 3300049581 Ga0501047_0030338 Ga0501047_0030338_3856_4464 186
124 3300009176 Ga0105242_10992467 Ga0105242_109924671 187
125 3300031249 Ga0265339_10225908 Ga0265339_102259082 187
126 3300000545 CNXas_1000001 CNXas_100000119 189
127 3300005364 Ga0070673_100459887 Ga0070673_1004598872 189
128 3300005365 Ga0070688_100093632 Ga0070688_1000936322 189
129 3300006237 Ga0097621_100290094 Ga0097621_1002900942 189
130 3300009553 Ga0105249_10264419 Ga0105249_102644192 189
131 3300013306 Ga0163162_10103819 Ga0163162_101038193 189
132 3300013308 Ga0157375_10144508 Ga0157375_101445083 189
133 3300014969 Ga0157376_10136483 Ga0157376_101364832 189
134 3300031240 Ga0265320_10000251 Ga0265320_1000025111 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

125

193

0.9

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

46

171

0.87

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

48

165

0.83

PF08645

PNK3P

Polynucleotide kinase 3 phosphatase

26

196

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fpx-assembly1.cif.gz_A crystal structure of the n-terminal domain of e.coli hisb- sulfate complex. 0.8631 8 181
2fpu-assembly1.cif.gz_B crystal structure of the n-terminal domain of e.coli hisb- complex with histidinol 0.8587 8 183
2fps-assembly1.cif.gz_B crystal structure of the n-terminal domain of e.coli hisb- apo ca model. 0.8528 8 183
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.8519 9 184
2fpu-assembly1.cif.gz_B crystal structure of the n-terminal domain of e.coli hisb- complex with histidinol 0.8487 8 183
ID Description Score Start End Superfamily
af_Q8ID74_14_228_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8529 7 139 3.40.50.1000
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8489 9 184 3.40.50.1000
af_P9WMV3_2_164_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8413 1 156 3.40.50.1000
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8398 9 184 3.40.50.1000
af_Q19683_29_218_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8385 7 152 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2V5MDU1-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.9791 1 186 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-B1ZZR8-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.9785 7 184 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A2V8PQ58-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9766 8 186 GO:0005737
GO:0005975
GO:0016791
AF-A0A3D3XBZ9-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.976 8 155 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A1F8V495-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.9756 7 181 GO:0005737
GO:0005975
GO:0016791
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.11 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map