F159758

General Info

Members Datasets Scaffolds Average Seq Length
134 58 136 345

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10032119|Ga0105239_100321193
Length 410
Sequence LNFSHSSLVYRWFIIYLRNRLCKYIKLIHKRIFIVIYCVPERLFIAGINDKLDAFPQHTYNAGMSIEDRYKLNKEITLIDIANELNVSKSTVSRALQNHHSIGAETTKAVHELAKKYNYQPNAIASSLFKKSTKTIGVIVPILSHYFFSTVIAGIEDVAYKAGYKVIICQSHELYEREVIVSKTLLSAKVDGLIVSVSKETVNMDHFQQFLDKNIPLIFFDRLPTGIQSNSVSVDDYEGAFKIVEHLIEQGCKRIAHFTGPLNIALAQNRLQGYKDALRKHHIPVNDELIYECGFERTQGITTTEKLLTDQVSVDAIFAVCDPVAIGVMLTLKQKSIKIPHDIAVVGFNDDPTATVIDPPLTTVAQPAFEIGVAAADIFLKQVIGPSRSYIKEVLKTNLTIRQSSLRKNR

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
17 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
18 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
27 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
28 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
29 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
30 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
31 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
32 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
33 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
34 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
35 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
36 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
37 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
40 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
41 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
42 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
43 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
44 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
45 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
46 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
47 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
48 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
49 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
50 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
51 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
52 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
53 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
54 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
55 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
56 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
57 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
58 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.69
Nodule 0
Rhizoplane 0
Rhizosphere 72.39
Stem 0
Stem Tuber 0
Unclassified 14.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000137 3300002737 Bacteria 78951
2 rootH1_10002106 3300003316 Bacteria 7429
3 rootH1_10020816 3300003316 Bacteria 5017
4 rootH1_10020816 3300003323 Bacteria 13962
5 rootH1_10108128 3300003316 Unclassified 2622
6 rootH2_10006168 3300003320 Bacteria 47117
7 rootH2_10155247 3300003320 Bacteria 2546
8 rootL2_10000158 3300003322 Bacteria 50986
9 rootL2_10151806 3300003322 Bacteria 8803
10 rootL2_10182522 3300003322 Bacteria 3065
11 rootL2_10245536 3300003322 Bacteria 3422
12 rootL2_10253416 3300003322 Bacteria 5406
13 rootH1_10009752 3300003323 Bacteria 15443
14 rootH1_10028721 3300003316 Bacteria 3181
15 rootH1_10028721 3300003323 Bacteria 8710
16 rootH1_10031428 3300003323 Bacteria 10538
17 rootH1_10034368 3300003323 Bacteria 15752
18 rootH1_10053290 3300003323 Bacteria 3180
19 rootH1_10101639 3300003323 Unclassified 4327
20 rootH1_10130046 3300003323 Bacteria 6113
21 rootH1_10279879 3300003323 Bacteria 2549
22 Ga0055531_10000223 3300003794 Bacteria 62728
23 Ga0065165_1001877 3300005262 Bacteria 20331
24 Ga0070680_100083793 3300005336 Bacteria 2633
25 Ga0070665_100389852 3300005548 Bacteria 1400
26 Ga0068855_100238895 3300005563 Bacteria 2031
27 Ga0068856_100090035 3300005614 Bacteria 3052
28 Ga0105240_10243221 3300009093 Bacteria 2085
29 Ga0105240_10324548 3300009093 Bacteria 1753
30 Ga0111539_10002515 3300009094 Bacteria 24297
31 Ga0111539_10011557 3300009094 Bacteria 11081
32 Ga0105239_10032119 3300010375 Bacteria 5770
33 Ga0105239_10034106 3300010375 Bacteria 5588
34 Ga0157372_10056567 3300013307 Bacteria 4383
35 Ga0209437_100143 3300025233 Bacteria 164970
36 Ga0209129_1010249 3300025258 Bacteria 2363
37 Ga0209050_1006797 3300025298 Bacteria 6659
38 Ga0209257_1000005 3300025304 Bacteria 1592528
39 Ga0207695_10254896 3300025913 Bacteria 1653
40 Ga0207671_10011166 3300025914 Bacteria 7335
41 Ga0207671_10024308 3300025914 Bacteria 4558
42 Ga0207660_10273998 3300025917 Bacteria 1337
43 Ga0207667_10031706 3300025949 Bacteria 5704
44 Ga0207702_10067391 3300026078 Bacteria 3072
45 Ga0268266_10333551 3300028379 Bacteria 1422
46 Ga0265334_10014998 3300028573 Bacteria 3225
47 Ga0265323_10000283 3300028653 Bacteria 29455
48 Ga0265323_10002273 3300028653 Bacteria 8910
49 Ga0265336_10011149 3300028666 Bacteria 3064
50 Ga0265338_10060036 3300028800 Bacteria 3346
51 Ga0265327_10046195 3300031251 Bacteria 2308
52 Ga0265327_10049172 3300031251 Bacteria 2213
53 Ga0265316_10003867 3300031344 Bacteria 15017
54 Ga0265316_10008318 3300031344 Bacteria 9631
55 Ga0307408_100003975 3300031548 Bacteria 10073
56 Ga0316576_10037919 3300031727 Bacteria 3453
57 Ga0316576_10113100 3300031727 Unclassified 2036
58 Ga0316576_10127878 3300031727 Bacteria 1910
59 Ga0307516_10221296 3300031730 Bacteria 1602
60 Ga0307405_10095948 3300031731 Unclassified 1976
61 Ga0307413_10040469 3300031824 Unclassified 2720
62 Ga0307412_10010343 3300031911 Bacteria 5372
63 Ga0307412_10322437 3300031911 Unclassified 1230
64 Ga0307416_100028150 3300032002 Unclassified 4175
65 Ga0307416_100276654 3300032002 Bacteria 1652
66 Ga0316574_0101550 3300035398 Bacteria 1841
67 Ga0316574_0117970 3300035398 Bacteria 1703
68 Ga0400483_259523 3300039062 Unclassified 2184
69 Ga0451577_0000010 3300042876 Bacteria 616686
70 Ga0451577_0000754 3300042876 Bacteria 49345
71 Ga0451577_0001692 3300042876 Bacteria 28454
72 Ga0451577_0012170 3300042876 Bacteria 8090
73 Ga0451577_0037503 3300042876 Bacteria 4362
74 Ga0451577_0099087 3300042876 Bacteria 2603
75 Ga0451577_0131775 3300042876 Bacteria 2243
76 Ga0451577_0317946 3300042876 Bacteria 1411
77 Ga0451577_0358815 3300042876 Bacteria 1322
78 Ga0453683_0000227 3300044673 Bacteria 75124
79 Ga0453683_0000768 3300044673 Bacteria 31862
80 Ga0453683_0001274 3300044673 Bacteria 22351
81 Ga0453683_0003299 3300044673 Bacteria 11953
82 Ga0453683_0007933 3300044673 Bacteria 7155
83 Ga0453683_0012485 3300044673 Bacteria 5566
84 Ga0453683_0183513 3300044673 Bacteria 1327
85 Ga0453683_0237494 3300044673 Unclassified 1160
86 Ga0466964_0018309 3300044706 Bacteria 2687
87 Ga0453684_0000191 3300044712 Bacteria 267816
88 Ga0453684_0000469 3300044712 Bacteria 160413
89 Ga0453684_0001194 3300044712 Bacteria 80254
90 Ga0453684_0001431 3300044712 Bacteria 68233
91 Ga0453684_0002120 3300044712 Bacteria 49982
92 Ga0453684_0002228 3300044712 Bacteria 48078
93 Ga0453684_0002542 3300044712 Bacteria 43901
94 Ga0453684_0004010 3300044712 Bacteria 32091
95 Ga0453684_0004774 3300044712 Bacteria 27951
96 Ga0453684_0007580 3300044712 Bacteria 19896
97 Ga0453684_0013670 3300044712 Bacteria 13150
98 Ga0453684_0017548 3300044712 Bacteria 11076
99 Ga0453684_0020937 3300044712 Bacteria 9810
100 Ga0453684_0062225 3300044712 Bacteria 4782
101 Ga0453684_0115763 3300044712 Bacteria 3248
102 Ga0453684_0126206 3300044712 Bacteria 3079
103 Ga0453684_0223729 3300044712 Bacteria 2178
104 Ga0453684_0349164 3300044712 Bacteria 1669
105 Ga0451576_0000297 3300045051 Bacteria 120836
106 Ga0451576_0001102 3300045051 Bacteria 49331
107 Ga0451576_0001626 3300045051 Bacteria 37654
108 Ga0451576_0001722 3300045051 Bacteria 36067
109 Ga0451576_0003347 3300045051 Bacteria 22204
110 Ga0451576_0004908 3300045051 Bacteria 17065
111 Ga0451576_0004911 3300045051 Bacteria 17059
112 Ga0451576_0005792 3300045051 Bacteria 15366
113 Ga0451576_0009708 3300045051 Bacteria 11130
114 Ga0451576_0017429 3300045051 Bacteria 7897
115 Ga0451576_0033783 3300045051 Bacteria 5435
116 Ga0451576_0037098 3300045051 Bacteria 5164
117 Ga0451576_0055156 3300045051 Bacteria 4159
118 Ga0451576_0176100 3300045051 Bacteria 2233
119 Ga0451576_0458887 3300045051 Unclassified 1338
120 Ga0495638_0000020 3300046460 Bacteria 372434
121 Ga0495597_0099605 3300046542 Bacteria 1227
122 Ga0501242_000704 3300049674 Unclassified 3083
123 Ga0501247_002117 3300049677 Unclassified 2031
124 Ga0501257_010384 3300049686 Unclassified 2113
125 Ga0501264_000192 3300049761 Bacteria 9804
126 nmdc:mga08y16_125744_c1 3300050511 Unclassified 2667
127 Ga0500583_0067164 3300053092 Unclassified 1708
128 Ga0500618_001942 3300053125 Bacteria 8487
129 Ga0500655_005563 3300053133 Unclassified 2270
130 Ga0500655_009152 3300053133 Unclassified 1783
131 Ga0500604_0000371 3300053151 Bacteria 12294
132 Ga0500616_0000004 3300053153 Bacteria 1002714
133 Ga0500616_0008019 3300053153 Bacteria 6615
134 Ga0500622_0000014 3300053156 Bacteria 368189
135 Ga0500622_0000020 3300053156 Bacteria 271239
136 Ga0500622_0022644 3300053156 Bacteria 3328

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0358815 Ga0451577_0358815_60_956 298
2 3300053125 Ga0500618_001942 Ga0500618_001942_6312_7367 323
3 3300044712 Ga0453684_0126206 Ga0453684_0126206_1258_2271 327
4 3300031548 Ga0307408_100003975 Ga0307408_1000039756 330
5 3300031911 Ga0307412_10010343 Ga0307412_100103432 330
6 3300032002 Ga0307416_100276654 Ga0307416_1002766542 330
7 3300049674 Ga0501242_000704 Ga0501242_000704_1033_2058 331
8 3300031251 Ga0265327_10046195 Ga0265327_100461952 335
9 3300031727 Ga0316576_10127878 Ga0316576_101278781 335
10 3300035398 Ga0316574_0117970 Ga0316574_0117970_557_1570 335
11 3300044712 Ga0453684_0004774 Ga0453684_0004774_18071_19084 335
12 3300045051 Ga0451576_0001722 Ga0451576_0001722_11442_12455 335
13 3300031727 Ga0316576_10037919 Ga0316576_100379192 336
14 3300035398 Ga0316574_0101550 Ga0316574_0101550_142_1158 336
15 3300042876 Ga0451577_0012170 Ga0451577_0012170_3047_4063 336
16 3300044673 Ga0453683_0000768 Ga0453683_0000768_21043_22059 336
17 3300044712 Ga0453684_0007580 Ga0453684_0007580_640_1656 336
18 3300044712 Ga0453684_0115763 Ga0453684_0115763_1189_2205 336
19 3300044712 Ga0453684_0223729 Ga0453684_0223729_858_1874 336
20 3300045051 Ga0451576_0001626 Ga0451576_0001626_16585_17601 336
21 3300045051 Ga0451576_0005792 Ga0451576_0005792_7448_8464 336
22 3300045051 Ga0451576_0033783 Ga0451576_0033783_2884_3900 336
23 3300045051 Ga0451576_0458887 Ga0451576_0458887_185_1201 336
24 3300042876 Ga0451577_0099087 Ga0451577_0099087_248_1267 337
25 3300042876 Ga0451577_0131775 Ga0451577_0131775_945_1964 337
26 3300042876 Ga0451577_0317946 Ga0451577_0317946_211_1230 337
27 3300044673 Ga0453683_0237494 Ga0453683_0237494_98_1117 337
28 3300044712 Ga0453684_0349164 Ga0453684_0349164_621_1640 337
29 3300045051 Ga0451576_0009708 Ga0451576_0009708_5013_6032 337
30 3300045051 Ga0451576_0176100 Ga0451576_0176100_496_1515 337
31 3300028653 Ga0265323_10002273 Ga0265323_100022737 338
32 3300031344 Ga0265316_10003867 Ga0265316_100038674 338
33 3300028573 Ga0265334_10014998 Ga0265334_100149982 339
34 3300028666 Ga0265336_10011149 Ga0265336_100111492 339
35 3300028800 Ga0265338_10060036 Ga0265338_100600362 339
36 3300039062 Ga0400483_259523 Ga0400483_259523_286_1308 339
37 3300044712 Ga0453684_0001194 Ga0453684_0001194_59980_60999 339
38 3300044712 Ga0453684_0002228 Ga0453684_0002228_24074_25108 339
39 3300044712 Ga0453684_0013670 Ga0453684_0013670_2692_3711 339
40 3300044712 Ga0453684_0062225 Ga0453684_0062225_1938_2978 339
41 3300003316 rootH1_10002106 rootH1_100021063 340
42 3300003316 rootH1_10020816 rootH1_100208162 340
43 3300003316 rootH1_10108128 rootH1_101081282 340
44 3300003320 rootH2_10006168 rootH2_100061689 340
45 3300003320 rootH2_10155247 rootH2_101552472 340
46 3300003322 rootL2_10000158 rootL2_1000015837 340
47 3300003322 rootL2_10151806 rootL2_101518062 340
48 3300003322 rootL2_10182522 rootL2_101825222 340
49 3300003322 rootL2_10245536 rootL2_102455362 340
50 3300003322 rootL2_10253416 rootL2_102534162 340
51 3300003323 rootH1_10009752 rootH1_100097524 340
52 3300003323 rootH1_10028721 rootH1_100287214 340
53 3300003323 rootH1_10031428 rootH1_100314286 340
54 3300003323 rootH1_10034368 rootH1_1003436810 340
55 3300003323 rootH1_10053290 rootH1_100532902 340
56 3300003323 rootH1_10101639 rootH1_101016392 340
57 3300003323 rootH1_10130046 rootH1_101300462 340
58 3300003323 rootH1_10279879 rootH1_102798791 340
59 3300003794 Ga0055531_10000223 Ga0055531_1000022338 340
60 3300005262 Ga0065165_1001877 Ga0065165_10018772 340
61 3300005336 Ga0070680_100083793 Ga0070680_1000837931 340
62 3300005548 Ga0070665_100389852 Ga0070665_1003898521 340
63 3300005614 Ga0068856_100090035 Ga0068856_1000900352 340
64 3300009093 Ga0105240_10324548 Ga0105240_103245482 340
65 3300009094 Ga0111539_10002515 Ga0111539_100025154 340
66 3300009094 Ga0111539_10011557 Ga0111539_100115573 340
67 3300025298 Ga0209050_1006797 Ga0209050_10067972 340
68 3300025304 Ga0209257_1000005 Ga0209257_10000051310 340
69 3300025917 Ga0207660_10273998 Ga0207660_102739981 340
70 3300026078 Ga0207702_10067391 Ga0207702_100673912 340
71 3300028379 Ga0268266_10333551 Ga0268266_103335511 340
72 3300028653 Ga0265323_10000283 Ga0265323_100002837 340
73 3300031251 Ga0265327_10049172 Ga0265327_100491722 340
74 3300031344 Ga0265316_10008318 Ga0265316_100083188 340
75 3300031727 Ga0316576_10113100 Ga0316576_101131002 340
76 3300031730 Ga0307516_10221296 Ga0307516_102212961 340
77 3300031731 Ga0307405_10095948 Ga0307405_100959482 340
78 3300031824 Ga0307413_10040469 Ga0307413_100404692 340
79 3300031911 Ga0307412_10322437 Ga0307412_103224371 340
80 3300032002 Ga0307416_100028150 Ga0307416_1000281501 340
81 3300042876 Ga0451577_0037503 Ga0451577_0037503_2531_3577 340
82 3300044673 Ga0453683_0012485 Ga0453683_0012485_1448_2491 340
83 3300044706 Ga0466964_0018309 Ga0466964_0018309_1207_2253 340
84 3300044712 Ga0453684_0002542 Ga0453684_0002542_24692_25738 340
85 3300045051 Ga0451576_0004908 Ga0451576_0004908_5079_6125 340
86 3300045051 Ga0451576_0055156 Ga0451576_0055156_2826_3869 340
87 3300046460 Ga0495638_0000020 Ga0495638_0000020_175482_176531 340
88 3300046542 Ga0495597_0099605 Ga0495597_0099605_86_1129 340
89 3300049677 Ga0501247_002117 Ga0501247_002117_871_1917 340
90 3300049686 Ga0501257_010384 Ga0501257_010384_711_1757 340
91 3300049761 Ga0501264_000192 Ga0501264_000192_6226_7272 340
92 3300050511 nmdc:mga08y16_125744_c1 nmdc:mga08y16_125744_c1_55_1104 340
93 3300053092 Ga0500583_0067164 Ga0500583_0067164_534_1586 340
94 3300053133 Ga0500655_005563 Ga0500655_005563_651_1694 340
95 3300053133 Ga0500655_009152 Ga0500655_009152_585_1625 340
96 3300053151 Ga0500604_0000371 Ga0500604_0000371_4549_5595 340
97 3300053153 Ga0500616_0000004 Ga0500616_0000004_934154_935203 340
98 3300053153 Ga0500616_0008019 Ga0500616_0008019_2549_3601 340
99 3300053156 Ga0500622_0000014 Ga0500622_0000014_175437_176480 340
100 3300053156 Ga0500622_0000020 Ga0500622_0000020_168939_169985 340
101 3300053156 Ga0500622_0022644 Ga0500622_0022644_1149_2198 340
102 3300042876 Ga0451577_0000010 Ga0451577_0000010_601206_602231 341
103 3300042876 Ga0451577_0000754 Ga0451577_0000754_2978_4006 341
104 3300042876 Ga0451577_0001692 Ga0451577_0001692_11511_12539 341
105 3300044673 Ga0453683_0001274 Ga0453683_0001274_2065_3093 341
106 3300044673 Ga0453683_0003299 Ga0453683_0003299_4591_5616 341
107 3300044673 Ga0453683_0007933 Ga0453683_0007933_195_1226 341
108 3300044712 Ga0453684_0000191 Ga0453684_0000191_14456_15481 341
109 3300044712 Ga0453684_0000469 Ga0453684_0000469_145794_146822 341
110 3300044712 Ga0453684_0001431 Ga0453684_0001431_43629_44663 341
111 3300044712 Ga0453684_0002120 Ga0453684_0002120_2978_4006 341
112 3300044712 Ga0453684_0017548 Ga0453684_0017548_9575_10606 341
113 3300044712 Ga0453684_0020937 Ga0453684_0020937_5629_6660 341
114 3300045051 Ga0451576_0000297 Ga0451576_0000297_70967_71995 341
115 3300045051 Ga0451576_0001102 Ga0451576_0001102_2972_4000 341
116 3300045051 Ga0451576_0003347 Ga0451576_0003347_6724_7749 341
117 3300045051 Ga0451576_0004911 Ga0451576_0004911_8324_9355 341
118 3300045051 Ga0451576_0017429 Ga0451576_0017429_6338_7363 341
119 3300005563 Ga0068855_100238895 Ga0068855_1002388952 342
120 3300044673 Ga0453683_0000227 Ga0453683_0000227_19940_20968 342
121 3300045051 Ga0451576_0037098 Ga0451576_0037098_4049_5077 342
122 3300013307 Ga0157372_10056567 Ga0157372_100565672 346
123 3300044673 Ga0453683_0183513 Ga0453683_0183513_164_1264 346
124 3300044712 Ga0453684_0004010 Ga0453684_0004010_16910_18010 346
125 3300002737 JGI25162J39368_1000137 JGI25162J39368_100013738 347
126 3300009093 Ga0105240_10243221 Ga0105240_102432212 347
127 3300010375 Ga0105239_10032119 Ga0105239_100321193 347
128 3300010375 Ga0105239_10034106 Ga0105239_100341063 347
129 3300025233 Ga0209437_100143 Ga0209437_100143110 347
130 3300025258 Ga0209129_1010249 Ga0209129_10102492 347
131 3300025913 Ga0207695_10254896 Ga0207695_102548962 347
132 3300025914 Ga0207671_10011166 Ga0207671_100111664 347
133 3300025914 Ga0207671_10024308 Ga0207671_100243083 347
134 3300025949 Ga0207667_10031706 Ga0207667_100317064 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00356

LacI

Bacterial regulatory proteins, lacI family

77

122

0.98

PF13377

Peripla_BP_3

Periplasmic binding protein-like domain

244

405

0.94

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

133

403

0.89

PF13407

Peripla_BP_4

Periplasmic binding protein domain

136

387

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3egc-assembly3.cif.gz_F crystal structure of a putative ribose operon repressor from burkholderia thailandensis 0.9401 70 337
3egc-assembly3.cif.gz_E crystal structure of a putative ribose operon repressor from burkholderia thailandensis 0.9395 70 337
2o20-assembly1.cif.gz_A crystal structure of transcription regulator ccpa of lactococcus lactis 0.9377 68 342
2o20-assembly1.cif.gz_A crystal structure of transcription regulator ccpa of lactococcus lactis 0.9311 68 342
3egc-assembly3.cif.gz_F crystal structure of a putative ribose operon repressor from burkholderia thailandensis 0.9264 70 337
ID Description Score Start End Superfamily
3kkeB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9562 174 300 3.40.50.2300
3k4hB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9504 174 300 3.40.50.2300
2o20A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9423 174 300 3.40.50.2300
1jhzB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.942 174 300 3.40.50.2300
2rgyA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9411 172 300 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3C0ZNV9-F1-model_v4 Transcriptional regulator LacI/GalR-like sensor domain-containing protein 0.969 85 347 GO:0000976
GO:0003700
AF-A0A1E4A2L6-F1-model_v4 LacI family transcriptional regulator 0.9669 101 343 GO:0000976
GO:0003700
AF-A0A532V423-F1-model_v4 LacI family transcriptional regulator 0.9601 173 342 GO:0000976
GO:0003700
AF-A0A1E4A2L6-F1-model_v4 LacI family transcriptional regulator 0.9591 101 343 GO:0000976
GO:0003700
AF-A0A7H4P3Q3-F1-model_v4 Regulatory protein 0.9494 167 341 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
90.18 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map