F159282

General Info

Members Datasets Scaffolds Average Seq Length
134 96 134 144

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100096350|Ga0068864_1000963502
Length 172
Sequence MSSFEYRSRVEACQKSFRPSTLSAWPLYAPGVSRKSAKIAELIEQCRGHALDAHYLGYFECFNRQLFYEAHDVLEELWLDDRKGPNDAFYKGLIQLAGAFVHLQKNRVRPSAALLKLARANLEKYPAAHQHLNVGQVLKVIDEWLELIESQEFAVNPLSNTNPPRLGLLTSA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
38 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
40 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
41 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
42 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
43 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
44 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
47 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
48 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
56 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
57 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
58 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
59 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
61 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
62 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
63 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
87 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
88 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.75
Rhizosphere 97.01
Stem 0
Stem Tuber 0
Unclassified 2.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10045819 3300003320 Bacteria 2473
2 rootH1_10192577 3300003323 Bacteria 1460
3 Ga0070658_10511157 3300005327 Unclassified 1038
4 Ga0070674_100637520 3300005356 Unclassified 904
5 Ga0070673_100737622 3300005364 Unclassified 906
6 Ga0070688_100021849 3300005365 Unclassified 3742
7 Ga0070714_100050349 3300005435 Bacteria 3548
8 Ga0070705_100227194 3300005440 Bacteria 1296
9 Ga0070681_10048561 3300005458 Bacteria 4240
10 Ga0068855_100172187 3300005563 Bacteria 2451
11 Ga0068855_101108786 3300005563 Bacteria 827
12 Ga0068852_102208928 3300005616 Unclassified 572
13 Ga0068859_100214583 3300005617 Bacteria 2011
14 Ga0068864_100096350 3300005618 Bacteria 2618
15 Ga0068860_100089778 3300005843 Bacteria 2926
16 Ga0097620_100214592 3300006931 Bacteria 2011
17 Ga0097620_101633852 3300006931 Bacteria 712
18 Ga0105240_10168825 3300009093 Bacteria 2593
19 Ga0105242_10072622 3300009176 Bacteria 2858
20 Ga0105242_10617385 3300009176 Bacteria 1050
21 Ga0105248_10447611 3300009177 Bacteria 1455
22 Ga0105237_10236156 3300009545 Bacteria 1829
23 Ga0105238_10008723 3300009551 Bacteria 10143
24 Ga0105238_10106010 3300009551 Bacteria 2792
25 Ga0157370_10240423 3300013104 Bacteria 1675
26 Ga0157374_10587339 3300013296 Bacteria 1123
27 Ga0157372_10540264 3300013307 Bacteria 1359
28 Ga0163163_10237255 3300014325 Bacteria 1873
29 Ga0163163_10634128 3300014325 Bacteria 1132
30 Ga0163163_10908901 3300014325 Bacteria 944
31 Ga0157376_11547862 3300014969 Unclassified 697
32 Ga0207707_10598843 3300025912 Bacteria 933
33 Ga0207695_10173395 3300025913 Bacteria 2081
34 Ga0207652_10162597 3300025921 Bacteria 2001
35 Ga0207694_10174775 3300025924 Unclassified 1740
36 Ga0207694_10199027 3300025924 Bacteria 1629
37 Ga0207664_10255557 3300025929 Bacteria 1531
38 Ga0207686_10177420 3300025934 Bacteria 1508
39 Ga0207670_10016517 3300025936 Unclassified 4438
40 Ga0207667_10505755 3300025949 Unclassified 1225
41 Ga0207667_10669006 3300025949 Bacteria 1042
42 Ga0207703_11072205 3300026035 Bacteria 774
43 Ga0207708_10399612 3300026075 Bacteria 1136
44 Ga0207698_11008352 3300026142 Bacteria 843
45 Ga0265355_1004044 3300028036 Bacteria 1096
46 Ga0268265_10188537 3300028380 Bacteria 1779
47 Ga0265337_1000305 3300028556 Bacteria 26124
48 Ga0265337_1000454 3300028556 Bacteria 21728
49 Ga0265337_1012415 3300028556 Bacteria 2895
50 Ga0265337_1035472 3300028556 Unclassified 1461
51 Ga0265326_10042947 3300028558 Bacteria 1283
52 Ga0265326_10118136 3300028558 Bacteria 754
53 Ga0265319_1014482 3300028563 Bacteria 3092
54 Ga0265319_1015915 3300028563 Viruses 2895
55 Ga0265334_10144293 3300028573 Unclassified 842
56 Ga0265323_10031283 3300028653 Unclassified 1979
57 Ga0265336_10015541 3300028666 Bacteria 2500
58 Ga0265338_10001504 3300028800 Bacteria 37705
59 Ga0265338_10003857 3300028800 Bacteria 20792
60 Ga0265338_10006741 3300028800 Bacteria 14504
61 Ga0265338_10015092 3300028800 Bacteria 8524
62 Ga0265338_10018060 3300028800 Bacteria 7568
63 Ga0265338_10107675 3300028800 Bacteria 2253
64 Ga0265338_10149041 3300028800 Bacteria 1820
65 Ga0265338_10366831 3300028800 Bacteria 1032
66 Ga0265338_10447570 3300028800 Bacteria 915
67 Ga0265338_10903116 3300028800 Bacteria 601
68 Ga0265324_10002022 3300029957 Bacteria 10795
69 Ga0307511_10264028 3300030521 Bacteria 813
70 Ga0265330_10082026 3300031235 Unclassified 1389
71 Ga0265320_10009243 3300031240 Bacteria 5960
72 Ga0265320_10105077 3300031240 Bacteria 1298
73 Ga0265325_10114391 3300031241 Unclassified 1307
74 Ga0265325_10169074 3300031241 Bacteria 1024
75 Ga0265329_10002382 3300031242 Bacteria 8540
76 Ga0265329_10131817 3300031242 Unclassified 805
77 Ga0265340_10173831 3300031247 Bacteria 975
78 Ga0265316_10036246 3300031344 Bacteria 3988
79 Ga0265316_10093954 3300031344 Unclassified 2285
80 Ga0265316_10164256 3300031344 Bacteria 1659
81 Ga0265316_10209753 3300031344 Bacteria 1441
82 Ga0265316_10339628 3300031344 Bacteria 1089
83 Ga0265314_10000499 3300031711 Bacteria 50725
84 Ga0265314_10167101 3300031711 Unclassified 1332
85 Ga0265342_10241238 3300031712 Unclassified 967
86 Ga0373930_0009042 3300034816 Bacteria 1755
87 Ga0373926_0131564 3300035083 Unclassified 948
88 Ga0373928_0000644 3300035084 Bacteria 6849
89 Ga0373923_0137127 3300035111 Bacteria 1104
90 Ga0373932_0000002 3300035112 Bacteria 711821
91 Ga0373945_0023046 3300035116 Bacteria 2149
92 Ga0373953_0265588 3300035117 Unclassified 747
93 Ga0373962_0000110 3300035242 Bacteria 17917
94 Ga0373931_0000012 3300035691 Bacteria 267735
95 Ga0373927_0100656 3300035695 Bacteria 1879
96 Ga0373947_0199043 3300035725 Unclassified 1310
97 Ga0373925_0035777 3300037068 Bacteria 3665
98 Ga0373925_0633707 3300037068 Unclassified 881
99 Ga0451807_0515400 3300041486 Bacteria 1636
100 Ga0451577_0064799 3300042876 Unclassified 3258
101 Ga0453683_0814312 3300044673 Unclassified 615
102 Ga0453684_0349855 3300044712 Bacteria 1667
103 Ga0453684_0725687 3300044712 Unclassified 1078
104 Ga0451576_0909671 3300045051 Unclassified 923
105 Ga0495592_0078632 3300046454 Bacteria 2389
106 Ga0495603_0860673 3300046455 Unclassified 516
107 Ga0495641_0161310 3300046461 Unclassified 1003
108 Ga0495651_0301346 3300046462 Bacteria 1075
109 Ga0495580_0347795 3300046472 Bacteria 1005
110 Ga0495582_0136206 3300046473 Bacteria 1389
111 Ga0495630_0000040 3300046517 Bacteria 106232
112 Ga0495630_0051341 3300046517 Bacteria 3087
113 Ga0495666_0015050 3300046526 Bacteria 3850
114 Ga0495586_0000018 3300046535 Bacteria 112658
115 Ga0495645_0124422 3300046543 Bacteria 1813
116 Ga0495645_0517555 3300046543 Unclassified 744
117 Ga0495667_0152673 3300046559 Bacteria 1487
118 Ga0495634_0007105 3300046642 Bacteria 8443
119 Ga0495634_0432664 3300046642 Bacteria 778
120 Ga0495635_0470084 3300046663 Bacteria 830
121 Ga0495599_0070827 3300046678 Bacteria 2176
122 Ga0495623_0532949 3300046679 Unclassified 617
123 Ga0495669_0111673 3300046684 Unclassified 1276
124 Ga0495613_0124409 3300046689 Bacteria 1850
125 Ga0495613_0260358 3300046689 Bacteria 1209
126 Ga0495581_0035646 3300047315 Bacteria 2878
127 Ga0495674_0000489 3300047319 Bacteria 36129
128 Ga0495674_0077178 3300047319 Bacteria 2864
129 Ga0495676_0019082 3300047321 Bacteria 6036
130 Ga0495676_0720374 3300047321 Bacteria 645
131 Ga0495683_0163742 3300047323 Unclassified 1027
132 Ga0495675_0295222 3300047444 Bacteria 964
133 nmdc:mga05p37_1221497_c1 3300050507 Bacteria 774
134 nmdc:mga08y16_660184_c1 3300050511 Bacteria 1049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10015092 Ga0265338_100150923 135
2 3300031344 Ga0265316_10093954 Ga0265316_100939542 135
3 3300005356 Ga0070674_100637520 Ga0070674_1006375201 138
4 3300005843 Ga0068860_100089778 Ga0068860_1000897784 138
5 3300009177 Ga0105248_10447611 Ga0105248_104476112 138
6 3300014325 Ga0163163_10634128 Ga0163163_106341282 138
7 3300014325 Ga0163163_10908901 Ga0163163_109089012 138
8 3300003323 rootH1_10192577 rootH1_101925772 139
9 3300005458 Ga0070681_10048561 Ga0070681_100485613 139
10 3300005563 Ga0068855_101108786 Ga0068855_1011087861 139
11 3300005616 Ga0068852_102208928 Ga0068852_1022089281 139
12 3300009093 Ga0105240_10168825 Ga0105240_101688252 139
13 3300009551 Ga0105238_10008723 Ga0105238_100087234 139
14 3300013307 Ga0157372_10540264 Ga0157372_105402642 139
15 3300014969 Ga0157376_11547862 Ga0157376_115478621 139
16 3300025912 Ga0207707_10598843 Ga0207707_105988431 139
17 3300025913 Ga0207695_10173395 Ga0207695_101733953 139
18 3300025921 Ga0207652_10162597 Ga0207652_101625972 139
19 3300025924 Ga0207694_10199027 Ga0207694_101990273 139
20 3300025949 Ga0207667_10669006 Ga0207667_106690061 139
21 3300026142 Ga0207698_11008352 Ga0207698_110083521 139
22 3300028556 Ga0265337_1000454 Ga0265337_10004546 139
23 3300028573 Ga0265334_10144293 Ga0265334_101442932 139
24 3300028800 Ga0265338_10018060 Ga0265338_100180605 139
25 3300028800 Ga0265338_10366831 Ga0265338_103668312 139
26 3300028800 Ga0265338_10903116 Ga0265338_109031162 139
27 3300035111 Ga0373923_0137127 Ga0373923_0137127_36_455 139
28 3300035117 Ga0373953_0265588 Ga0373953_0265588_113_532 139
29 3300042876 Ga0451577_0064799 Ga0451577_0064799_1004_1423 139
30 3300044673 Ga0453683_0814312 Ga0453683_0814312_47_466 139
31 3300044712 Ga0453684_0349855 Ga0453684_0349855_450_869 139
32 3300046454 Ga0495592_0078632 Ga0495592_0078632_864_1283 139
33 3300046462 Ga0495651_0301346 Ga0495651_0301346_485_904 139
34 3300046517 Ga0495630_0051341 Ga0495630_0051341_34_453 139
35 3300046543 Ga0495645_0124422 Ga0495645_0124422_61_480 139
36 3300046559 Ga0495667_0152673 Ga0495667_0152673_364_783 139
37 3300046642 Ga0495634_0432664 Ga0495634_0432664_72_491 139
38 3300046663 Ga0495635_0470084 Ga0495635_0470084_39_458 139
39 3300046678 Ga0495599_0070827 Ga0495599_0070827_1228_1647 139
40 3300046679 Ga0495623_0532949 Ga0495623_0532949_61_480 139
41 3300046689 Ga0495613_0124409 Ga0495613_0124409_315_734 139
42 3300047319 Ga0495674_0077178 Ga0495674_0077178_710_1129 139
43 3300047323 Ga0495683_0163742 Ga0495683_0163742_260_679 139
44 3300047444 Ga0495675_0295222 Ga0495675_0295222_460_879 139
45 3300005327 Ga0070658_10511157 Ga0070658_105111572 140
46 3300005365 Ga0070688_100021849 Ga0070688_1000218494 140
47 3300005563 Ga0068855_100172187 Ga0068855_1001721871 140
48 3300009176 Ga0105242_10072622 Ga0105242_100726223 140
49 3300025949 Ga0207667_10505755 Ga0207667_105057552 140
50 3300028563 Ga0265319_1014482 Ga0265319_10144823 140
51 3300028563 Ga0265319_1015915 Ga0265319_10159152 140
52 3300028800 Ga0265338_10006741 Ga0265338_100067419 140
53 3300028800 Ga0265338_10447570 Ga0265338_104475702 140
54 3300030521 Ga0307511_10264028 Ga0307511_102640281 140
55 3300031235 Ga0265330_10082026 Ga0265330_100820262 140
56 3300031240 Ga0265320_10009243 Ga0265320_100092435 140
57 3300031240 Ga0265320_10105077 Ga0265320_101050772 140
58 3300031241 Ga0265325_10114391 Ga0265325_101143912 140
59 3300031242 Ga0265329_10131817 Ga0265329_101318171 140
60 3300031247 Ga0265340_10173831 Ga0265340_101738311 140
61 3300031344 Ga0265316_10036246 Ga0265316_100362463 140
62 3300031711 Ga0265314_10167101 Ga0265314_101671011 140
63 3300031712 Ga0265342_10241238 Ga0265342_102412382 140
64 3300034816 Ga0373930_0009042 Ga0373930_0009042_923_1348 140
65 3300035083 Ga0373926_0131564 Ga0373926_0131564_138_563 140
66 3300035084 Ga0373928_0000644 Ga0373928_0000644_4102_4527 140
67 3300035112 Ga0373932_0000002 Ga0373932_0000002_160227_160652 140
68 3300035116 Ga0373945_0023046 Ga0373945_0023046_26_451 140
69 3300035242 Ga0373962_0000110 Ga0373962_0000110_8574_8999 140
70 3300035691 Ga0373931_0000012 Ga0373931_0000012_160246_160671 140
71 3300035695 Ga0373927_0100656 Ga0373927_0100656_310_735 140
72 3300035725 Ga0373947_0199043 Ga0373947_0199043_23_448 140
73 3300037068 Ga0373925_0035777 Ga0373925_0035777_1532_1957 140
74 3300005364 Ga0070673_100737622 Ga0070673_1007376222 141
75 3300005435 Ga0070714_100050349 Ga0070714_1000503492 141
76 3300005440 Ga0070705_100227194 Ga0070705_1002271941 141
77 3300005617 Ga0068859_100214583 Ga0068859_1002145832 141
78 3300005618 Ga0068864_100096350 Ga0068864_1000963502 141
79 3300006931 Ga0097620_100214592 Ga0097620_1002145922 141
80 3300006931 Ga0097620_101633852 Ga0097620_1016338522 141
81 3300009176 Ga0105242_10617385 Ga0105242_106173851 141
82 3300013104 Ga0157370_10240423 Ga0157370_102404231 141
83 3300013296 Ga0157374_10587339 Ga0157374_105873392 141
84 3300014325 Ga0163163_10237255 Ga0163163_102372552 141
85 3300025929 Ga0207664_10255557 Ga0207664_102555572 141
86 3300025934 Ga0207686_10177420 Ga0207686_101774202 141
87 3300025936 Ga0207670_10016517 Ga0207670_100165172 141
88 3300026035 Ga0207703_11072205 Ga0207703_110722052 141
89 3300026075 Ga0207708_10399612 Ga0207708_103996122 141
90 3300028380 Ga0268265_10188537 Ga0268265_101885372 141
91 3300028556 Ga0265337_1000305 Ga0265337_10003059 141
92 3300028556 Ga0265337_1012415 Ga0265337_10124152 141
93 3300028556 Ga0265337_1035472 Ga0265337_10354724 141
94 3300028558 Ga0265326_10042947 Ga0265326_100429472 141
95 3300028558 Ga0265326_10118136 Ga0265326_101181362 141
96 3300028653 Ga0265323_10031283 Ga0265323_100312833 141
97 3300028666 Ga0265336_10015541 Ga0265336_100155412 141
98 3300028800 Ga0265338_10001504 Ga0265338_1000150418 141
99 3300028800 Ga0265338_10003857 Ga0265338_1000385712 141
100 3300028800 Ga0265338_10107675 Ga0265338_101076752 141
101 3300028800 Ga0265338_10149041 Ga0265338_101490412 141
102 3300029957 Ga0265324_10002022 Ga0265324_100020222 141
103 3300031241 Ga0265325_10169074 Ga0265325_101690742 141
104 3300031242 Ga0265329_10002382 Ga0265329_100023824 141
105 3300031344 Ga0265316_10164256 Ga0265316_101642564 141
106 3300031344 Ga0265316_10209753 Ga0265316_102097531 141
107 3300031344 Ga0265316_10339628 Ga0265316_103396282 141
108 3300031711 Ga0265314_10000499 Ga0265314_1000049927 141
109 3300037068 Ga0373925_0633707 Ga0373925_0633707_315_740 141
110 3300041486 Ga0451807_0515400 Ga0451807_0515400_653_1081 141
111 3300044712 Ga0453684_0725687 Ga0453684_0725687_599_1024 141
112 3300045051 Ga0451576_0909671 Ga0451576_0909671_160_600 141
113 3300046455 Ga0495603_0860673 Ga0495603_0860673_58_486 141
114 3300046461 Ga0495641_0161310 Ga0495641_0161310_68_502 141
115 3300046472 Ga0495580_0347795 Ga0495580_0347795_561_995 141
116 3300046473 Ga0495582_0136206 Ga0495582_0136206_583_1017 141
117 3300046517 Ga0495630_0000040 Ga0495630_0000040_76976_77410 141
118 3300046526 Ga0495666_0015050 Ga0495666_0015050_67_501 141
119 3300046535 Ga0495586_0000018 Ga0495586_0000018_25572_26006 141
120 3300046543 Ga0495645_0517555 Ga0495645_0517555_253_714 141
121 3300046642 Ga0495634_0007105 Ga0495634_0007105_1862_2296 141
122 3300046684 Ga0495669_0111673 Ga0495669_0111673_725_1165 141
123 3300046689 Ga0495613_0260358 Ga0495613_0260358_189_623 141
124 3300047315 Ga0495581_0035646 Ga0495581_0035646_1846_2280 141
125 3300047319 Ga0495674_0000489 Ga0495674_0000489_14168_14602 141
126 3300047321 Ga0495676_0019082 Ga0495676_0019082_4603_5037 141
127 3300047321 Ga0495676_0720374 Ga0495676_0720374_131_562 141
128 3300050507 nmdc:mga05p37_1221497_c1 nmdc:mga05p37_1221497_c1_279_725 141
129 3300050511 nmdc:mga08y16_660184_c1 nmdc:mga08y16_660184_c1_539_964 141
130 3300003320 rootH2_10045819 rootH2_100458194 142
131 3300009545 Ga0105237_10236156 Ga0105237_102361561 142
132 3300009551 Ga0105238_10106010 Ga0105238_101060102 142
133 3300025924 Ga0207694_10174775 Ga0207694_101747753 142
134 3300028036 Ga0265355_1004044 Ga0265355_10040442 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03745

DUF309

Domain of unknown function (DUF309)

55

114

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ijq-assembly2.cif.gz_B crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 0.8688 24 138
4zey-assembly1.cif.gz_A crystal structure of a nuclear receptor binding factor 2 mit domain (nrbf2) from homo sapiens at 1.50 a resolution 0.7961 54 121
2ijq-assembly2.cif.gz_B crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 0.7857 24 138
2ijq-assembly1.cif.gz_A crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 0.7492 13 131
2crb-assembly1.cif.gz_A solution structure of mit domain from mouse nrbf-2 0.721 54 121
ID Description Score Start End Superfamily
2ijqB00 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.8688 24 138 1.10.3450.10
af_Q4D7C7_4_76_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8369 58 124 1.20.58.80
af_Q2FY75_1_133_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.8343 24 138 1.10.3450.10
af_Q9VHF6_403_478_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8186 58 124 1.20.58.80
af_O80675_54_197_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.8152 13 122 1.10.3450.10
ID Description Score Start End GO Terms
AF-A0A535DMX7-F1-model_v4 DUF309 domain-containing protein 0.9735 21 94
AF-A0A0C1UV85-F1-model_v4 deleted 0.9663 30 120
AF-A0A846ATQ7-F1-model_v4 DUF309 domain-containing protein 0.9553 24 121
AF-A0A2T6DEM2-F1-model_v4 DUF309 domain-containing protein 0.9548 1 140
AF-A0A2V5MQB5-F1-model_v4 DUF309 domain-containing protein 0.9534 1 141

Feature Viewer

pLDDT pTM Quality
91.84 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map