F158842

General Info

Members Datasets Scaffolds Average Seq Length
134 104 268 134

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100470772|Ga0070661_1004707722
Length 153
Sequence MAGARLRAALKSQEGVTTMSARSLEKFPIHLGKGATAVPQPEFPRDERAMDWYMDYARRTAEDGSEGRVISLFRFTEDWGGWEMHPAGDEVVVCLTGEMRLTQEFPDGRVETVTLKPGEYAINPPGVWHTADIPVETSGLFVTAGAGTQNRPR

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
74 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
75 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
76 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
77 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
78 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
84 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
93 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
94 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
95 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
99 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
100 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
101 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.96
Nodule 0
Rhizoplane 2.24
Rhizosphere 83.58
Stem 0
Stem Tuber 0
Unclassified 6.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100470772 3300005344 Bacteria 1002
2 JGI24738J21930_10012895 3300002075 Bacteria 1817
3 Ga0070658_10090145 3300005327 Bacteria 2526
4 Ga0070683_100195133 3300005329 Bacteria 1922
5 Ga0070682_100298487 3300005337 Bacteria 1181
6 Ga0070692_10042024 3300005345 Bacteria 2345
7 Ga0070668_100549085 3300005347 Bacteria 1005
8 Ga0070675_100619565 3300005354 Bacteria 982
9 Ga0070673_100416827 3300005364 Bacteria 1203
10 Ga0070659_100102869 3300005366 Bacteria 2300
11 Ga0070659_100542069 3300005366 Bacteria 995
12 Ga0070703_10071051 3300005406 Bacteria 1163
13 Ga0070694_100671730 3300005444 Bacteria 840
14 Ga0070663_100988470 3300005455 Bacteria 731
15 Ga0070662_100025350 3300005457 Bacteria 4094
16 Ga0070662_100086175 3300005457 Bacteria 2349
17 Ga0070679_100001685 3300005530 Bacteria 19884
18 Ga0070684_100027716 3300005535 Bacteria 4785
19 Ga0070684_100563184 3300005535 Bacteria 1058
20 Ga0068853_102100548 3300005539 Unclassified 548
21 Ga0070696_100745132 3300005546 Bacteria 802
22 Ga0068855_100894979 3300005563 Bacteria 938
23 Ga0068854_101917230 3300005578 Bacteria 545
24 Ga0068852_100472411 3300005616 Bacteria 1245
25 Ga0068852_100905760 3300005616 Bacteria 899
26 Ga0068859_100303765 3300005617 Bacteria 1689
27 Ga0068862_100338328 3300005844 Bacteria 1393
28 Ga0075363_100376675 3300006048 Bacteria 831
29 Ga0075364_10027291 3300006051 Bacteria 3646
30 Ga0097621_101456123 3300006237 Bacteria 649
31 Ga0075370_10295688 3300006353 Bacteria 963
32 Ga0068871_101212254 3300006358 Bacteria 708
33 Ga0075428_100228820 3300006844 Bacteria 2006
34 Ga0075428_100348827 3300006844 Bacteria 1589
35 Ga0075430_100566058 3300006846 Bacteria 937
36 Ga0075433_10256850 3300006852 Bacteria 1550
37 Ga0097620_100303764 3300006931 Bacteria 1689
38 Ga0111539_10002891 3300009094 Bacteria 22802
39 Ga0111539_10060368 3300009094 Bacteria 4494
40 Ga0105237_12104307 3300009545 Unclassified 573
41 Ga0105238_11398430 3300009551 Bacteria 727
42 Ga0105249_10419014 3300009553 Bacteria 1372
43 Ga0105246_10000083 3300011119 Bacteria 40197
44 Ga0105246_11157840 3300011119 Bacteria 709
45 Ga0157373_10115348 3300013100 Bacteria 1888
46 Ga0157371_10024400 3300013102 Bacteria 4416
47 Ga0157370_11496238 3300013104 Bacteria 607
48 Ga0157369_10431846 3300013105 Bacteria 1365
49 Ga0157369_11237052 3300013105 Bacteria 762
50 Ga0157374_11042948 3300013296 Bacteria 837
51 Ga0157372_10676229 3300013307 Bacteria 1202
52 Ga0157375_10189874 3300013308 Bacteria 2209
53 Ga0163163_11741662 3300014325 Bacteria 684
54 Ga0157380_12057615 3300014326 Bacteria 633
55 Ga0157380_12854168 3300014326 Bacteria 550
56 Ga0213876_10210255 3300021384 Unclassified 1034
57 Ga0207426_1054059 3300025302 Bacteria 1183
58 Ga0207649_10445964 3300025920 Bacteria 976
59 Ga0207652_10001403 3300025921 Bacteria 21372
60 Ga0207659_11812193 3300025926 Bacteria 518
61 Ga0207706_10050348 3300025933 Bacteria 3681
62 Ga0207661_10159496 3300025944 Bacteria 1956
63 Ga0207679_10176805 3300025945 Bacteria 1762
64 Ga0207667_10200210 3300025949 Bacteria 2049
65 Ga0207712_10272588 3300025961 Bacteria 1377
66 Ga0207668_10686487 3300025972 Bacteria 899
67 Ga0207678_10003188 3300026067 Bacteria 14838
68 Ga0207698_10164352 3300026142 Bacteria 1946
69 Ga0207698_10656018 3300026142 Bacteria 1040
70 Ga0265327_10520644 3300031251 Unclassified 512
71 Ga0307413_11315926 3300031824 Bacteria 633
72 Ga0307406_12025432 3300031901 Bacteria 515
73 Ga0307412_10028682 3300031911 Bacteria 3485
74 Ga0307412_11019576 3300031911 Bacteria 732
75 Ga0307416_100059605 3300032002 Bacteria 3103
76 Ga0307416_100204582 3300032002 Bacteria 1877
77 Ga0307414_10040478 3300032004 Bacteria 3148
78 Ga0307414_10062900 3300032004 Bacteria 2636
79 Ga0307414_10409845 3300032004 Bacteria 1179
80 Ga0307414_10472233 3300032004 Bacteria 1104
81 Ga0307414_10947581 3300032004 Bacteria 791
82 Ga0307411_10408954 3300032005 Bacteria 1124
83 Ga0307415_100524449 3300032126 Unclassified 1040
84 Ga0307415_101717997 3300032126 Bacteria 606
85 Ga0307415_101970010 3300032126 Bacteria 568
86 Ga0316574_0273689 3300035398 Bacteria 1077
87 Ga0436365_0428237 3300039437 Bacteria 3954
88 Ga0436363_0812708 3300039450 Bacteria 820
89 Ga0451791_1924633 3300041451 Bacteria 1165
90 Ga0451853_3279703 3300041512 Bacteria 922
91 Ga0495671_0104499 3300046692 Bacteria 1383
92 Ga0496108_1263811 3300048911 Bacteria 622
93 Ga0496114_0017183 3300048917 Bacteria 5835
94 Ga0496122_0027037 3300048925 Bacteria 4920
95 Ga0496123_0013713 3300048926 Bacteria 6777
96 Ga0496126_0078724 3300048929 Bacteria 2920
97 Ga0501031_0469041 3300049568 Bacteria 813
98 Ga0501034_0063540 3300049571 Bacteria 3705
99 Ga0501034_1075755 3300049571 Bacteria 686
100 Ga0501037_0387529 3300049573 Bacteria 960
101 Ga0501040_0429972 3300049576 Bacteria 949
102 Ga0501067_0416983 3300049583 Bacteria 749
103 Ga0501068_0337916 3300049584 Bacteria 967
104 Ga0501071_0274291 3300049587 Bacteria 1276
105 Ga0501071_0484971 3300049587 Bacteria 948
106 Ga0501071_0615164 3300049587 Bacteria 835
107 Ga0501071_1210676 3300049587 Bacteria 583
108 Ga0501073_0479671 3300049589 Bacteria 860
109 Ga0501074_0603527 3300049590 Unclassified 776
110 Ga0501075_0844296 3300049591 Bacteria 697
111 Ga0501076_0247086 3300049592 Bacteria 1460
112 Ga0501076_0616214 3300049592 Unclassified 895
113 Ga0501076_1481071 3300049592 Unclassified 557
114 Ga0501079_0251735 3300049741 Bacteria 1381
115 Ga0501079_0470228 3300049741 Bacteria 988
116 Ga0501081_1545453 3300049743 Bacteria 504
117 Ga0501083_1033595 3300049744 Bacteria 535
118 nmdc:mga0k408_553232_c1 3300050493 Bacteria 680
119 nmdc:mga07m45_320181_c1 3300050496 Unclassified 901
120 nmdc:mga07m45_412078_c1 3300050496 Bacteria 784
121 nmdc:mga09592_733615_c1 3300050508 Bacteria 839
122 nmdc:mga0qj67_531132_c1 3300050509 Bacteria 944
123 nmdc:mga08y16_160968_c1 3300050511 Bacteria 2332
124 nmdc:mga08y16_6225_c1 3300050511 Bacteria 12516
125 Ga0500643_005813 3300053087 Bacteria 5256
126 Ga0500643_007341 3300053087 Bacteria 4465
127 Ga0500594_0004424 3300053118 Bacteria 3096
128 Ga0500559_0022888 3300053136 Bacteria 2651
129 Ga0500616_0001679 3300053153 Bacteria 20402
130 Ga0501084_0793065 3300054114 Bacteria 798
131 Ga0501084_1089009 3300054114 Bacteria 671
132 Ga0501084_1599498 3300054114 Bacteria 545
133 Ga0501082_1585852 3300060353 Bacteria 572
134 Ga0530510_0037216 3300061734 Bacteria 3508
135 Ga0070661_100470772
136 JGI24738J21930_10012895
137 Ga0070658_10090145
138 Ga0070683_100195133
139 Ga0070682_100298487
140 Ga0070692_10042024
141 Ga0070668_100549085
142 Ga0070675_100619565
143 Ga0070673_100416827
144 Ga0070659_100102869
145 Ga0070659_100542069
146 Ga0070703_10071051
147 Ga0070694_100671730
148 Ga0070663_100988470
149 Ga0070662_100025350
150 Ga0070662_100086175
151 Ga0070679_100001685
152 Ga0070684_100027716
153 Ga0070684_100563184
154 Ga0068853_102100548
155 Ga0070696_100745132
156 Ga0068855_100894979
157 Ga0068854_101917230
158 Ga0068852_100472411
159 Ga0068852_100905760
160 Ga0068859_100303765
161 Ga0068862_100338328
162 Ga0075363_100376675
163 Ga0075364_10027291
164 Ga0097621_101456123
165 Ga0075370_10295688
166 Ga0068871_101212254
167 Ga0075428_100228820
168 Ga0075428_100348827
169 Ga0075430_100566058
170 Ga0075433_10256850
171 Ga0097620_100303764
172 Ga0111539_10002891
173 Ga0111539_10060368
174 Ga0105237_12104307
175 Ga0105238_11398430
176 Ga0105249_10419014
177 Ga0105246_10000083
178 Ga0105246_11157840
179 Ga0157373_10115348
180 Ga0157371_10024400
181 Ga0157370_11496238
182 Ga0157369_10431846
183 Ga0157369_11237052
184 Ga0157374_11042948
185 Ga0157372_10676229
186 Ga0157375_10189874
187 Ga0163163_11741662
188 Ga0157380_12057615
189 Ga0157380_12854168
190 Ga0213876_10210255
191 Ga0207426_1054059
192 Ga0207649_10445964
193 Ga0207652_10001403
194 Ga0207659_11812193
195 Ga0207706_10050348
196 Ga0207661_10159496
197 Ga0207679_10176805
198 Ga0207667_10200210
199 Ga0207712_10272588
200 Ga0207668_10686487
201 Ga0207678_10003188
202 Ga0207698_10164352
203 Ga0207698_10656018
204 Ga0265327_10520644
205 Ga0307413_11315926
206 Ga0307406_12025432
207 Ga0307412_10028682
208 Ga0307412_11019576
209 Ga0307416_100059605
210 Ga0307416_100204582
211 Ga0307414_10040478
212 Ga0307414_10062900
213 Ga0307414_10409845
214 Ga0307414_10472233
215 Ga0307414_10947581
216 Ga0307411_10408954
217 Ga0307415_100524449
218 Ga0307415_101717997
219 Ga0307415_101970010
220 Ga0316574_0273689
221 Ga0436365_0428237
222 Ga0436363_0812708
223 Ga0451791_1924633
224 Ga0451853_3279703
225 Ga0495671_0104499
226 Ga0496108_1263811
227 Ga0496114_0017183
228 Ga0496122_0027037
229 Ga0496123_0013713
230 Ga0496126_0078724
231 Ga0501031_0469041
232 Ga0501034_0063540
233 Ga0501034_1075755
234 Ga0501037_0387529
235 Ga0501040_0429972
236 Ga0501067_0416983
237 Ga0501068_0337916
238 Ga0501071_0274291
239 Ga0501071_0484971
240 Ga0501071_0615164
241 Ga0501071_1210676
242 Ga0501073_0479671
243 Ga0501074_0603527
244 Ga0501075_0844296
245 Ga0501076_0247086
246 Ga0501076_0616214
247 Ga0501076_1481071
248 Ga0501079_0251735
249 Ga0501079_0470228
250 Ga0501081_1545453
251 Ga0501083_1033595
252 nmdc:mga0k408_553232_c1
253 nmdc:mga07m45_320181_c1
254 nmdc:mga07m45_412078_c1
255 nmdc:mga09592_733615_c1
256 nmdc:mga0qj67_531132_c1
257 nmdc:mga08y16_160968_c1
258 nmdc:mga08y16_6225_c1
259 Ga0500643_005813
260 Ga0500643_007341
261 Ga0500594_0004424
262 Ga0500559_0022888
263 Ga0500616_0001679
264 Ga0501084_0793065
265 Ga0501084_1089009
266 Ga0501084_1599498
267 Ga0501082_1585852
268 Ga0530510_0037216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

76

145

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.8892 50 126
6bh3-assembly1.cif.gz_A linked kdm5a jmj domain bound to the inhibitor (s)-n-(1-(3-isopropyl-1h-pyrazole-5-carbonyl)pyrrolidin-3-yl)cyclopropanecarboxamide (compound n55) 0.8798 50 124
1yhf-assembly1.cif.gz_A crystal structure of conserved spy1581 protein of unknown function from streptococcus pyogenes 0.8772 50 126
6dq7-assembly1.cif.gz_A linked kdm5a jmj domain bound to the potential hydrolysis product of inhibitor n45 i.e. 3-((6-(4-(2-cyano-3-methylbut-2-enoyl)-1,4-diazepan-1-yl)-2-(pyridin-2-yl)pyrimidin-4-yl)amino)propanoic acid 0.8659 51 123
6xwu-assembly1.cif.gz_A-2 crystal structure of drosophila melanogaster cenp-c cumin domain 0.8635 52 124
ID Description Score Start End Superfamily
2ozjB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.885 50 126 2.60.120.10
af_Q10LJ3_463_844_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8571 91 124 2.60.120.650
af_Q5U3F8_5_287_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8525 50 124 2.60.120.10
af_Q9FLT3_18_198_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.845 50 131 2.60.120.10
af_Q19341_4_281_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8434 50 124 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6I4URP2-F1-model_v4 Cupin domain-containing protein 0.9993 3 135
AF-A0A2I6QNI2-F1-model_v4 Uncharacterized protein 0.9944 53 135
AF-A0A841LB73-F1-model_v4 Quercetin dioxygenase-like cupin family protein 0.9851 2 135 GO:0051213
AF-A0A842HVG1-F1-model_v4 Cupin domain-containing protein 0.9837 1 135
AF-A0A6H2DNG9-F1-model_v4 Cupin 0.9811 2 135

Map