F157280

General Info

Members Datasets Scaffolds Average Seq Length
133 99 266 326

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0122390|Ga0466972_0122390_73_1164
Length 363
Sequence LEKIACGDFFETPQLFRPQKARLLRPAQHFGGPAMQLGMIGLGRMGANMVRRLQRGGHQCVAFDRSPDAVKDVAQSGARGANSLQDFVAALSKPRAIWIMVPAAVVDSVLKDLRPLLSPGDIIIDGGNSHYHDDIRRAEELKAAGLHYLDVGTSGGVLGLERGFCLMIGGDKESVERLDPIFATLAPGGTPGAGNTATRGYLHCGQHGAGHFVKMVHNGIEYGLMAAYAEGFNILKHADAGLGTRATDAETAPLSNPSHFQYQLDIGAIAELWRHGSIIGSSLLDLAAAALAKDPQLQQFAGRVADSGEGRWTLQAAIEEGVPAYVLSAALYSRFASRDRAEYADKVLSAMRLGFGGHHEGPG

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
68 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
69 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
86 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
87 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
88 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
89 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
90 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
91 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
92 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
93 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
94 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
95 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
96 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
97 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
98 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
99 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.53
Nodule 0
Rhizoplane 3.76
Rhizosphere 81.95
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0122390 3300044658 Bacteria 1227
2 JGI25406J46586_10030838 3300003203 Bacteria 2013
3 Ga0065707_10083178 3300005295 Bacteria 10105
4 Ga0070670_100041815 3300005331 Bacteria 3939
5 Ga0070666_10027156 3300005335 Bacteria 3747
6 Ga0070680_100085936 3300005336 Bacteria 2599
7 Ga0070671_100029429 3300005355 Bacteria 4528
8 Ga0070688_100220350 3300005365 Bacteria 1337
9 Ga0070667_100000184 3300005367 Bacteria 75408
10 Ga0070714_100261128 3300005435 Bacteria 1604
11 Ga0070713_100033131 3300005436 Bacteria 4135
12 Ga0070708_100329752 3300005445 Bacteria 1438
13 Ga0070681_10001544 3300005458 Bacteria 20388
14 Ga0070681_10002406 3300005458 Bacteria 17107
15 Ga0070681_10049775 3300005458 Bacteria 4183
16 Ga0070681_10066897 3300005458 Unclassified 3562
17 Ga0070681_10506547 3300005458 Bacteria 1120
18 Ga0070699_100130313 3300005518 Bacteria 2217
19 Ga0070679_100007834 3300005530 Bacteria 10016
20 Ga0070679_100214997 3300005530 Bacteria 1885
21 Ga0068859_100117553 3300005617 Bacteria 2724
22 Ga0068859_100287477 3300005617 Bacteria 1737
23 Ga0068858_100227883 3300005842 Bacteria 1766
24 Ga0081455_10003109 3300005937 Bacteria 19318
25 Ga0081455_10127245 3300005937 Bacteria 1997
26 Ga0081539_10000006 3300005985 Bacteria 534555
27 Ga0075365_10014276 3300006038 Bacteria 4775
28 Ga0075364_10006885 3300006051 Bacteria 6711
29 Ga0075430_100062026 3300006846 Bacteria 3141
30 Ga0097620_100117554 3300006931 Bacteria 2724
31 Ga0097620_100287490 3300006931 Bacteria 1737
32 Ga0105240_10369617 3300009093 Bacteria 1622
33 Ga0105238_10099203 3300009551 Bacteria 2896
34 Ga0157370_10093886 3300013104 Bacteria 2815
35 Ga0157369_10046183 3300013105 Bacteria 4734
36 Ga0157369_10063360 3300013105 Bacteria 3983
37 Ga0157369_10085757 3300013105 Bacteria 3365
38 Ga0157369_10454103 3300013105 Bacteria 1327
39 Ga0157372_10006190 3300013307 Bacteria 12719
40 Ga0163163_10662017 3300014325 Bacteria 1108
41 Ga0157379_10027245 3300014968 Bacteria 5088
42 Ga0213871_10049066 3300021441 Bacteria 1152
43 Ga0207707_10002518 3300025912 Bacteria 16477
44 Ga0207707_10017571 3300025912 Bacteria 6238
45 Ga0207707_10018879 3300025912 Bacteria 6014
46 Ga0207707_10037703 3300025912 Bacteria 4224
47 Ga0207695_10052370 3300025913 Bacteria 4277
48 Ga0207693_10017767 3300025915 Bacteria 5672
49 Ga0207660_10063990 3300025917 Bacteria 2654
50 Ga0207652_10020576 3300025921 Bacteria 5437
51 Ga0207652_10140916 3300025921 Bacteria 2156
52 Ga0207652_10149133 3300025921 Bacteria 2094
53 Ga0207650_10413502 3300025925 Bacteria 1118
54 Ga0207665_10143452 3300025939 Bacteria 1705
55 Ga0207712_10017976 3300025961 Bacteria 4600
56 Ga0207658_10000591 3300025986 Bacteria 32569
57 Ga0207703_10182558 3300026035 Bacteria 1852
58 Ga0265326_10008311 3300028558 Bacteria 3134
59 Ga0265326_10016065 3300028558 Bacteria 2166
60 Ga0265319_1068474 3300028563 Bacteria 1140
61 Ga0265334_10000690 3300028573 Bacteria 16902
62 Ga0265334_10003865 3300028573 Bacteria 6753
63 Ga0265318_10002523 3300028577 Bacteria 9724
64 Ga0265318_10006984 3300028577 Bacteria 5147
65 Ga0265322_10012114 3300028654 Bacteria 2494
66 Ga0307515_10003416 3300028794 Bacteria 33442
67 Ga0265338_10018305 3300028800 Bacteria 7504
68 Ga0265338_10087645 3300028800 Bacteria 2585
69 Ga0265338_10167413 3300028800 Bacteria 1690
70 Ga0265330_10004617 3300031235 Bacteria 6963
71 Ga0265328_10001910 3300031239 Bacteria 9467
72 Ga0265320_10036025 3300031240 Bacteria 2504
73 Ga0265340_10024513 3300031247 Bacteria 3063
74 Ga0265339_10016121 3300031249 Bacteria 4464
75 Ga0265331_10013458 3300031250 Bacteria 4397
76 Ga0265331_10143622 3300031250 Bacteria 1085
77 Ga0265327_10003466 3300031251 Bacteria 15011
78 Ga0265316_10036343 3300031344 Bacteria 3983
79 Ga0307509_10020156 3300031507 Bacteria 7576
80 Ga0307509_10083482 3300031507 Bacteria 3293
81 Ga0307408_100338583 3300031548 Bacteria 1273
82 Ga0265313_10003526 3300031595 Bacteria 12619
83 Ga0265313_10012124 3300031595 Bacteria 5303
84 Ga0265314_10021036 3300031711 Bacteria 5027
85 Ga0307416_100013293 3300032002 Bacteria 5590
86 Ga0373935_0034602 3300035692 Bacteria 3150
87 Ga0373947_0034652 3300035725 Bacteria 2986
88 Ga0436360_0949605 3300039438 Bacteria 3052
89 Ga0436360_0977244 3300039438 Bacteria 2203
90 Ga0436360_1007982 3300039438 Bacteria 2874
91 Ga0436361_0099933 3300039447 Bacteria 1160
92 Ga0436361_0857264 3300039447 Bacteria 1570
93 Ga0436361_1133404 3300039447 Bacteria 2690
94 Ga0436363_0375975 3300039450 Bacteria 36949
95 Ga0436363_0537007 3300039450 Bacteria 2552
96 Ga0436362_0925404 3300039453 Bacteria 1370
97 Ga0439442_027050 3300042002 Bacteria 1195
98 Ga0439445_0012937 3300042004 Bacteria 2013
99 Ga0466969_0002306 3300044656 Bacteria 10186
100 Ga0466969_0038357 3300044656 Bacteria 2411
101 Ga0466966_0001723 3300044684 Bacteria 14140
102 Ga0466961_0018926 3300044693 Bacteria 4430
103 Ga0466964_0000158 3300044706 Bacteria 18604
104 Ga0466971_0000297 3300044719 Bacteria 19087
105 Ga0466970_0002601 3300044765 Bacteria 8700
106 Ga0466957_0023926 3300044842 Bacteria 3614
107 Ga0466960_0010766 3300044901 Bacteria 3807
108 Ga0466959_0000251 3300045049 Bacteria 33248
109 Ga0466959_0009025 3300045049 Bacteria 7073
110 Ga0466958_0106017 3300045836 Bacteria 1752
111 Ga0495632_0063677 3300046519 Bacteria 1785
112 Ga0495658_0250202 3300046683 Bacteria 1114
113 Ga0496102_0020347 3300048905 Bacteria 5865
114 Ga0496112_0005194 3300048915 Bacteria 11197
115 Ga0496112_0008509 3300048915 Bacteria 9194
116 Ga0496113_0045979 3300048916 Bacteria 3240
117 Ga0501083_0000239 3300049744 Bacteria 35330
118 nmdc:mga00v17_5534_c1 3300050491 Bacteria 6657
119 nmdc:mga0rr50_12905_c1 3300050513 Bacteria 5418
120 Ga0495612_0162897 3300053078 Bacteria 974
121 Ga0500651_0000027 3300053093 Bacteria 116666
122 Ga0500554_086788 3300053102 Bacteria 1036
123 Ga0500556_0000455 3300053104 Bacteria 28996
124 Ga0500617_032559 3300053124 Bacteria 2334
125 Ga0500652_133771 3300053131 Bacteria 1034
126 Ga0500658_0081110 3300053134 Bacteria 1387
127 Ga0500577_0000064 3300053142 Bacteria 24153
128 Ga0500577_0068519 3300053142 Unclassified 1385
129 Ga0500616_0000064 3300053153 Bacteria 243072
130 Ga0500616_0007872 3300053153 Bacteria 6701
131 Ga0500622_0005858 3300053156 Bacteria 7269
132 Ga0501084_0000322 3300054114 Bacteria 36608
133 2600376963 2600254933 Bacteria 4750527
134 Ga0466972_0122390
135 JGI25406J46586_10030838
136 Ga0065707_10083178
137 Ga0070670_100041815
138 Ga0070666_10027156
139 Ga0070680_100085936
140 Ga0070671_100029429
141 Ga0070688_100220350
142 Ga0070667_100000184
143 Ga0070714_100261128
144 Ga0070713_100033131
145 Ga0070708_100329752
146 Ga0070681_10001544
147 Ga0070681_10002406
148 Ga0070681_10049775
149 Ga0070681_10066897
150 Ga0070681_10506547
151 Ga0070699_100130313
152 Ga0070679_100007834
153 Ga0070679_100214997
154 Ga0068859_100117553
155 Ga0068859_100287477
156 Ga0068858_100227883
157 Ga0081455_10003109
158 Ga0081455_10127245
159 Ga0081539_10000006
160 Ga0075365_10014276
161 Ga0075364_10006885
162 Ga0075430_100062026
163 Ga0097620_100117554
164 Ga0097620_100287490
165 Ga0105240_10369617
166 Ga0105238_10099203
167 Ga0157370_10093886
168 Ga0157369_10046183
169 Ga0157369_10063360
170 Ga0157369_10085757
171 Ga0157369_10454103
172 Ga0157372_10006190
173 Ga0163163_10662017
174 Ga0157379_10027245
175 Ga0213871_10049066
176 Ga0207707_10002518
177 Ga0207707_10017571
178 Ga0207707_10018879
179 Ga0207707_10037703
180 Ga0207695_10052370
181 Ga0207693_10017767
182 Ga0207660_10063990
183 Ga0207652_10020576
184 Ga0207652_10140916
185 Ga0207652_10149133
186 Ga0207650_10413502
187 Ga0207665_10143452
188 Ga0207712_10017976
189 Ga0207658_10000591
190 Ga0207703_10182558
191 Ga0265326_10008311
192 Ga0265326_10016065
193 Ga0265319_1068474
194 Ga0265334_10000690
195 Ga0265334_10003865
196 Ga0265318_10002523
197 Ga0265318_10006984
198 Ga0265322_10012114
199 Ga0307515_10003416
200 Ga0265338_10018305
201 Ga0265338_10087645
202 Ga0265338_10167413
203 Ga0265330_10004617
204 Ga0265328_10001910
205 Ga0265320_10036025
206 Ga0265340_10024513
207 Ga0265339_10016121
208 Ga0265331_10013458
209 Ga0265331_10143622
210 Ga0265327_10003466
211 Ga0265316_10036343
212 Ga0307509_10020156
213 Ga0307509_10083482
214 Ga0307408_100338583
215 Ga0265313_10003526
216 Ga0265313_10012124
217 Ga0265314_10021036
218 Ga0307416_100013293
219 Ga0373935_0034602
220 Ga0373947_0034652
221 Ga0436360_0949605
222 Ga0436360_0977244
223 Ga0436360_1007982
224 Ga0436361_0099933
225 Ga0436361_0857264
226 Ga0436361_1133404
227 Ga0436363_0375975
228 Ga0436363_0537007
229 Ga0436362_0925404
230 Ga0439442_027050
231 Ga0439445_0012937
232 Ga0466969_0002306
233 Ga0466969_0038357
234 Ga0466966_0001723
235 Ga0466961_0018926
236 Ga0466964_0000158
237 Ga0466971_0000297
238 Ga0466970_0002601
239 Ga0466957_0023926
240 Ga0466960_0010766
241 Ga0466959_0000251
242 Ga0466959_0009025
243 Ga0466958_0106017
244 Ga0495632_0063677
245 Ga0495658_0250202
246 Ga0496102_0020347
247 Ga0496112_0005194
248 Ga0496112_0008509
249 Ga0496113_0045979
250 Ga0501083_0000239
251 nmdc:mga00v17_5534_c1
252 nmdc:mga0rr50_12905_c1
253 Ga0495612_0162897
254 Ga0500651_0000027
255 Ga0500554_086788
256 Ga0500556_0000455
257 Ga0500617_032559
258 Ga0500652_133771
259 Ga0500658_0081110
260 Ga0500577_0000064
261 Ga0500577_0068519
262 Ga0500616_0000064
263 Ga0500616_0007872
264 Ga0500622_0005858
265 Ga0501084_0000322
266 2600376963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

36

199

0.97

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

210

248

0.94

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

36

129

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zca-assembly1.cif.gz_A-2 crystal structure of the f191m/f201a variant of variovorax paradoxus indole monooxygenase (vpinda1) in complex with benzyl phenyl sulfoxide 0.9495 1 33
2vvl-assembly4.cif.gz_F the structure of mao-n-d3, a variant of monoamine oxidase from aspergillus niger. 0.9485 2 30
7z98-assembly1.cif.gz_A crystal structure of f191m variant variovorax paradoxus indole monooxygenase (vpinda1) in complex with methyl phenyl sulfide 0.948 1 33
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 0.9475 2 30
2vvm-assembly1.cif.gz_B the structure of mao-n-d5, a variant of monoamine oxidase from aspergillus niger. 0.947 2 30
ID Description Score Start End Superfamily
af_O65404_36_399_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9516 2 32 3.50.50.60
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9498 1 136 3.40.50.720
3zdnC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9421 2 30 3.50.50.60
af_Q54BK7_6_401_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9404 3 32 3.50.50.60
af_Q9C1W3_1_361_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9327 3 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2M7WZ84-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 1 1 152 GO:0004616
GO:0050661
AF-A0A534C3M2-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.997 1 144 GO:0004616
GO:0050661
AF-A0A2M7WZ84-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9936 1 152 GO:0004616
GO:0050661
AF-A0A2T2STP7-F1-model_v4 6-phosphogluconate dehydrogenase 0.9928 1 117 GO:0004616
GO:0050661
AF-A0A7C2WQY9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9918 1 114 GO:0004616
GO:0050661

Map