F157216

General Info

Members Datasets Scaffolds Average Seq Length
133 105 266 278

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0031095|Ga0439449_0031095_728_1612
Length 294
Sequence MATATDTQKAPSKSIGEIASDALVRLVNGFLDALGQIGDFAFFSAKALYSIPRSLKRYHKESLRQLSDIAWGSGAILVGGGTIGIMILLSVAAGTSLGIEGFNGLELVGLAPLTGFISASANTRELAPIIAALALGSQIGCRFTAQLGSMKIHEEVDALEVMAVDAVEFLVTSRVIATMVAILPLYLIGLVGSYIASQVTVVLLFGQSPGQFDHYFSTFIQPRDVMLSVVKILVFALAVALIHCWYGMRVSGGPQSVGEATGRAIRASIVTVIVLDMIMTLVFWGGDPGFRVSG

Samples

Sample ID Description Type Environment
1 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
24 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
25 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
26 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
27 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
28 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
29 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
30 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
31 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
32 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
33 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
34 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
35 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
36 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
37 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
38 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
39 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
40 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
41 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
42 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
43 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
44 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
45 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
46 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
47 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
48 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
49 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
50 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
51 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
52 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
53 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
54 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
55 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
56 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
57 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
58 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
59 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
60 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
61 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
62 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
63 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
74 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
75 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
78 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
79 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
80 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
81 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
82 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
83 2547132424 Nocardia nova SH22a Isolate Unclassified
84 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
85 2643221590 Nocardioides sp. Root682 Isolate Unclassified
86 2643221604 Nocardioides sp. Root190 Isolate Unclassified
87 2643221617 Nocardioides sp. Root79 Isolate Unclassified
88 2643221620 Nocardioides sp. Root240 Isolate Unclassified
89 2643221692 Nocardia sp. Root136 Isolate Unclassified
90 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
91 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
92 2738541305 Nocardioides sp. CF167 Isolate Unclassified
93 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
94 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
95 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
96 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
97 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
98 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
99 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
100 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
101 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
102 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
103 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
104 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
105 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 75.19
Metatranscriptomes 0
Isolates 24.81

Biome Distribution

Category Percentage (%)
Aerial Root 1.5
Bulb 0
Endosphere 7.52
Nodule 0
Rhizoplane 7.52
Rhizosphere 57.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439449_0031095 3300042007 Bacteria 1990
2 Ga0055540_1000020 3300003792 Bacteria 210282
3 Ga0055540_1000141 3300003792 Bacteria 72085
4 Ga0070658_10027231 3300005327 Bacteria 4589
5 Ga0070666_10419886 3300005335 Bacteria 963
6 Ga0070660_100011552 3300005339 Bacteria 6284
7 Ga0070659_100083252 3300005366 Bacteria 2557
8 Ga0070667_100002212 3300005367 Bacteria 17107
9 Ga0070714_100154809 3300005435 Bacteria 2068
10 Ga0070714_100174757 3300005435 Bacteria 1951
11 Ga0070708_100222298 3300005445 Bacteria 1771
12 Ga0070698_100003098 3300005471 Bacteria 18331
13 Ga0081455_10002553 3300005937 Bacteria 21610
14 Ga0075363_100045270 3300006048 Bacteria 2333
15 Ga0075370_10055491 3300006353 Bacteria 2251
16 Ga0068865_100525252 3300006881 Bacteria 990
17 Ga0105237_10051207 3300009545 Bacteria 4147
18 Ga0105237_10154289 3300009545 Bacteria 2293
19 Ga0105239_10009575 3300010375 Bacteria 10898
20 Ga0105239_10085208 3300010375 Bacteria 3482
21 Ga0105239_10212347 3300010375 Bacteria 2169
22 Ga0209051_1000072 3300025303 Bacteria 210334
23 Ga0209051_1000323 3300025303 Bacteria 72149
24 Ga0207680_10075688 3300025903 Bacteria 2100
25 Ga0207647_10060860 3300025904 Bacteria 2307
26 Ga0207705_10134601 3300025909 Bacteria 1841
27 Ga0207657_10003212 3300025919 Bacteria 17497
28 Ga0207664_10006424 3300025929 Bacteria 8087
29 Ga0265327_10000041 3300031251 Bacteria 288506
30 Ga0265327_10001252 3300031251 Bacteria 33839
31 Ga0307412_10083163 3300031911 Bacteria 2218
32 Ga0395900_0004933 3300037418 Bacteria 14051
33 Ga0395900_0032313 3300037418 Bacteria 5381
34 Ga0395898_0363100 3300037466 Bacteria 1381
35 Ga0395898_0640117 3300037466 Bacteria 1006
36 Ga0395905_0442156 3300037471 Bacteria 1198
37 Ga0439442_011015 3300042002 Bacteria 1837
38 Ga0439448_0066811 3300042005 Bacteria 1194
39 Ga0466965_0002572 3300044683 Bacteria 7752
40 Ga0466965_0201299 3300044683 Bacteria 1056
41 Ga0466966_0048109 3300044684 Bacteria 2717
42 Ga0466971_0007712 3300044719 Bacteria 4693
43 Ga0466970_0012110 3300044765 Bacteria 4404
44 Ga0466970_0012918 3300044765 Bacteria 4276
45 Ga0466970_0069716 3300044765 Bacteria 1890
46 Ga0466957_0005933 3300044842 Bacteria 6882
47 Ga0466959_0245652 3300045049 Bacteria 1235
48 Ga0466958_0046953 3300045836 Bacteria 2606
49 Ga0466958_0373815 3300045836 Bacteria 919
50 Ga0466967_0024374 3300045976 Bacteria 4973
51 Ga0466967_0211234 3300045976 Bacteria 1841
52 Ga0495634_0229738 3300046642 Bacteria 1142
53 Ga0495635_0213250 3300046663 Bacteria 1307
54 Ga0495613_0117346 3300046689 Bacteria 1914
55 Ga0495683_0001994 3300047323 Bacteria 12701
56 Ga0496100_0000045 3300048903 Bacteria 77867
57 Ga0496101_0000142 3300048904 Bacteria 63473
58 Ga0496102_0006564 3300048905 Bacteria 9935
59 Ga0496103_0019719 3300048906 Bacteria 4047
60 Ga0496107_0000230 3300048910 Bacteria 29567
61 Ga0496108_0002281 3300048911 Bacteria 15368
62 Ga0496109_0000048 3300048912 Bacteria 129278
63 Ga0496110_0012536 3300048913 Bacteria 6972
64 Ga0496114_0000126 3300048917 Bacteria 54963
65 Ga0496115_0248968 3300048918 Bacteria 1463
66 Ga0496116_0003412 3300048919 Bacteria 15716
67 Ga0496117_0043644 3300048920 Bacteria 3257
68 Ga0496118_0064486 3300048921 Bacteria 2687
69 Ga0496119_0001381 3300048922 Bacteria 29532
70 Ga0496120_0030955 3300048923 Bacteria 3246
71 Ga0496121_0000016 3300048924 Bacteria 562911
72 Ga0496122_0000490 3300048925 Bacteria 82168
73 Ga0496123_0001140 3300048926 Bacteria 39712
74 Ga0496124_0000095 3300048927 Bacteria 184593
75 Ga0496125_0000151 3300048928 Bacteria 153487
76 Ga0496126_0000015 3300048929 Bacteria 663212
77 Ga0501032_0016924 3300049569 Bacteria 5125
78 Ga0501033_0002202 3300049570 Bacteria 16819
79 Ga0501034_0193526 3300049571 Bacteria 1995
80 Ga0501036_0062752 3300049572 Bacteria 3147
81 Ga0501037_0001474 3300049573 Bacteria 17236
82 Ga0501038_0009387 3300049574 Bacteria 8975
83 Ga0501039_0094959 3300049575 Bacteria 2324
84 Ga0501039_0216510 3300049575 Bacteria 1506
85 Ga0501043_0001478 3300049579 Bacteria 20554
86 Ga0501043_0094288 3300049579 Bacteria 2353
87 Ga0501046_0000617 3300049580 Bacteria 34979
88 Ga0501048_0021745 3300049582 Bacteria 4694
89 Ga0501070_0032244 3300049586 Bacteria 4385
90 Ga0501070_0051200 3300049586 Bacteria 3428
91 Ga0501072_0080464 3300049588 Bacteria 2581
92 Ga0501074_0127894 3300049590 Bacteria 1818
93 Ga0501080_0017300 3300049742 Bacteria 6664
94 Ga0501044_0035073 3300049823 Bacteria 5255
95 nmdc:mga00v17_30058_c1 3300050491 Bacteria 3193
96 nmdc:mga0yw44_220629_c1 3300050492 Bacteria 1256
97 nmdc:mga07m45_44880_c1 3300050496 Bacteria 2481
98 nmdc:mga07m45_61138_c1 3300050496 Bacteria 2133
99 Ga0466962_0011833 3300061719 Bacteria 4199
100 Ga0466962_0222535 3300061719 Bacteria 924
101 2523383082 2523231044 Bacteria 6434991
102 2548693784 2547132424 Bacteria 8348532
103 2548694157 2547132424 Bacteria 8348532
104 2548696945 2547132424 Bacteria 8348532
105 2548699868 2547132424 Bacteria 8348532
106 2552110791 2551306166 Bacteria 9731570
107 2643957896 2643221590 Bacteria 5214697
108 2643959812 2643221590 Bacteria 5214697
109 2644034404 2643221604 Bacteria 5014917
110 2644098549 2643221617 Bacteria 5139111
111 2644114592 2643221620 Bacteria 5134593
112 2644511648 2643221692 Bacteria 7282860
113 2644511912 2643221692 Bacteria 7282860
114 2644514741 2643221692 Bacteria 7282860
115 2644517560 2643221692 Bacteria 7282860
116 2644538048 2643221697 Bacteria 3575694
117 2738666542 2738541264 Bacteria 5935393
118 2738869820 2738541305 Bacteria 4910150
119 2739146466 2738541356 Bacteria 5935017
120 2744954449 2744054611 Bacteria 5611514
121 2753038629 2751185725 Bacteria 5740550
122 2753327141 2751185792 Bacteria 5739090
123 2809196318 2808606439 Bacteria 5952208
124 2812332521 2811994874 Bacteria 5367947
125 2812351520 2811994878 Bacteria 5992952
126 2891970873 2891968417 Bacteria 5821697
127 2902793337 2902792274 Bacteria 7270173
128 2919714966 2919713450 Bacteria 7431245
129 2919716342 2919713450 Bacteria 7431245
130 2919719632 2919713450 Bacteria 7431245
131 2932399624 2932398195 Bacteria 3847976
132 2984580279 2984576629 Bacteria 4248407
133 2990259129 2990256926 Bacteria 4252839
134 Ga0439449_0031095
135 Ga0055540_1000020
136 Ga0055540_1000141
137 Ga0070658_10027231
138 Ga0070666_10419886
139 Ga0070660_100011552
140 Ga0070659_100083252
141 Ga0070667_100002212
142 Ga0070714_100154809
143 Ga0070714_100174757
144 Ga0070708_100222298
145 Ga0070698_100003098
146 Ga0081455_10002553
147 Ga0075363_100045270
148 Ga0075370_10055491
149 Ga0068865_100525252
150 Ga0105237_10051207
151 Ga0105237_10154289
152 Ga0105239_10009575
153 Ga0105239_10085208
154 Ga0105239_10212347
155 Ga0209051_1000072
156 Ga0209051_1000323
157 Ga0207680_10075688
158 Ga0207647_10060860
159 Ga0207705_10134601
160 Ga0207657_10003212
161 Ga0207664_10006424
162 Ga0265327_10000041
163 Ga0265327_10001252
164 Ga0307412_10083163
165 Ga0395900_0004933
166 Ga0395900_0032313
167 Ga0395898_0363100
168 Ga0395898_0640117
169 Ga0395905_0442156
170 Ga0439442_011015
171 Ga0439448_0066811
172 Ga0466965_0002572
173 Ga0466965_0201299
174 Ga0466966_0048109
175 Ga0466971_0007712
176 Ga0466970_0012110
177 Ga0466970_0012918
178 Ga0466970_0069716
179 Ga0466957_0005933
180 Ga0466959_0245652
181 Ga0466958_0046953
182 Ga0466958_0373815
183 Ga0466967_0024374
184 Ga0466967_0211234
185 Ga0495634_0229738
186 Ga0495635_0213250
187 Ga0495613_0117346
188 Ga0495683_0001994
189 Ga0496100_0000045
190 Ga0496101_0000142
191 Ga0496102_0006564
192 Ga0496103_0019719
193 Ga0496107_0000230
194 Ga0496108_0002281
195 Ga0496109_0000048
196 Ga0496110_0012536
197 Ga0496114_0000126
198 Ga0496115_0248968
199 Ga0496116_0003412
200 Ga0496117_0043644
201 Ga0496118_0064486
202 Ga0496119_0001381
203 Ga0496120_0030955
204 Ga0496121_0000016
205 Ga0496122_0000490
206 Ga0496123_0001140
207 Ga0496124_0000095
208 Ga0496125_0000151
209 Ga0496126_0000015
210 Ga0501032_0016924
211 Ga0501033_0002202
212 Ga0501034_0193526
213 Ga0501036_0062752
214 Ga0501037_0001474
215 Ga0501038_0009387
216 Ga0501039_0094959
217 Ga0501039_0216510
218 Ga0501043_0001478
219 Ga0501043_0094288
220 Ga0501046_0000617
221 Ga0501048_0021745
222 Ga0501070_0032244
223 Ga0501070_0051200
224 Ga0501072_0080464
225 Ga0501074_0127894
226 Ga0501080_0017300
227 Ga0501044_0035073
228 nmdc:mga00v17_30058_c1
229 nmdc:mga0yw44_220629_c1
230 nmdc:mga07m45_44880_c1
231 nmdc:mga07m45_61138_c1
232 Ga0466962_0011833
233 Ga0466962_0222535
234 2523383082
235 2548693784
236 2548694157
237 2548696945
238 2548699868
239 2552110791
240 2643957896
241 2643959812
242 2644034404
243 2644098549
244 2644114592
245 2644511648
246 2644511912
247 2644514741
248 2644517560
249 2644538048
250 2738666542
251 2738869820
252 2739146466
253 2744954449
254 2753038629
255 2753327141
256 2809196318
257 2812332521
258 2812351520
259 2891970873
260 2902793337
261 2919714966
262 2919716342
263 2919719632
264 2932399624
265 2984580279
266 2990259129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

73

282

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fef-assembly1.cif.gz_J structure of mce1 transporter from mycobacterium smegmatis (map0) 0.9472 26 277
7d08-assembly1.cif.gz_A acinetobacter mlafedb complex in atp-bound vtrans1 conformation 0.9111 14 276
8fef-assembly1.cif.gz_J structure of mce1 transporter from mycobacterium smegmatis (map0) 0.9056 26 277
7d08-assembly1.cif.gz_A acinetobacter mlafedb complex in atp-bound vtrans1 conformation 0.9011 14 276
8fee-assembly1.cif.gz_I structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.887 23 273
ID Description Score Start End Superfamily
af_A0A1D6PYN6_84_244_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4092 78 268 1.10.1760.20
af_Q3V050_53_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4061 78 255 1.20.1250.20
af_A0A1D6PYN6_84_244_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4008 78 268 1.10.1760.20
af_Q6Z493_269_427_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.398 89 268 1.20.1250.20
af_Q3V050_53_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3963 78 255 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A5N5E7V5-F1-model_v4 ABC transporter permease 0.9802 40 278 GO:0005548
GO:0043190
AF-A0A538LD40-F1-model_v4 ABC transporter permease 0.978 75 243 GO:0005548
GO:0043190
AF-A0A317DFS1-F1-model_v4 ABC transporter permease 0.9704 22 245 GO:0005548
GO:0043190
AF-A0A7J5DRX7-F1-model_v4 ABC transporter permease 0.966 26 285 GO:0005548
GO:0043190
AF-A0A4R4UAQ6-F1-model_v4 ABC transporter permease 0.9658 35 285 GO:0005548
GO:0043190

Map