F156640

General Info

Members Datasets Scaffolds Average Seq Length
133 113 266 215

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10329301|Ga0207678_103293012
Length 262
Sequence MTHRRSARISSRKEPKQARSTELVAAILEAAVQVLAKEGAHRFTTARVAEKAGVSVGSLYQYFPNKAAILFRLQSDEWHQTTELLRSILEDARRPPLHRLRTLVHTFIRSECDEATIRVALHDAAPLYRDAPEAQQAKASGALAVRTFMRQALPKSSEATRAAEYGHGTAEHDHADNDPDDRRCGPECGCVWPGHNREGGDRSDDGERNAAERWLAILEQPHCSCEHEQQDAEADEQYELVRCAEGADDPFFEPGWRQVDDP

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
55 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
56 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
57 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
58 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
59 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
60 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
61 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
62 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
63 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
64 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
65 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
66 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
71 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
72 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
73 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
74 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
75 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
76 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
79 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
80 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
81 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
82 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
83 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
84 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
85 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
86 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
87 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
88 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
89 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
90 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
91 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
92 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
93 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
94 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
95 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
96 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
97 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
98 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
99 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
100 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
101 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
102 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
103 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
104 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
105 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
106 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
107 2738541277 Variovorax sp. GV051 Isolate Unclassified
108 2738543019 Variovorax sp. GV040 Isolate Unclassified
109 2841760612 Bosea sp. Tri-49 Isolate Nodule
110 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
111 2844104063 Bosea sp. Tri-39 Isolate Nodule
112 2851246043 Bosea sp. Tri-54 Isolate Nodule
113 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.23
Metatranscriptomes 0
Isolates 6.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 37.59
Nodule 3.01
Rhizoplane 8.27
Rhizosphere 34.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10329301 3300026067 Bacteria 1315
2 JGI25162J39368_1004726 3300002737 Bacteria 3012
3 JGI25153J46596_10000884 3300003215 Bacteria 18219
4 JGI25153J46596_10008104 3300003215 Bacteria 5067
5 JGI25404J52841_10003705 3300003659 Bacteria 3041
6 JGI25404J52841_10012967 3300003659 Bacteria 1808
7 Ga0055526_1001022 3300003771 Bacteria 20465
8 Ga0055524_1020828 3300003775 Bacteria 2195
9 Ga0055536_1004031 3300003781 Bacteria 7659
10 Ga0055528_1000044 3300003790 Bacteria 102325
11 Ga0055530_10009339 3300003791 Bacteria 3784
12 Ga0055530_10034242 3300003791 Bacteria 1299
13 Ga0055531_10001453 3300003794 Bacteria 17469
14 Ga0070670_100000697 3300005331 Bacteria 26100
15 Ga0070669_100067743 3300005353 Bacteria 2634
16 Ga0070659_100005582 3300005366 Bacteria 9038
17 Ga0070714_100209546 3300005435 Bacteria 1786
18 Ga0068855_100524251 3300005563 Bacteria 1285
19 Ga0068854_100000142 3300005578 Bacteria 49834
20 Ga0081540_1000741 3300005983 Bacteria 30012
21 Ga0081540_1009972 3300005983 Bacteria 6476
22 Ga0081539_10006630 3300005985 Bacteria 10988
23 Ga0075365_10254778 3300006038 Bacteria 1233
24 Ga0075368_10063948 3300006042 Bacteria 1476
25 Ga0075364_10030844 3300006051 Bacteria 3442
26 Ga0075362_10155717 3300006177 Bacteria 1098
27 Ga0075362_10310909 3300006177 Bacteria 783
28 Ga0075367_10143028 3300006178 Bacteria 1482
29 Ga0075367_10379014 3300006178 Bacteria 894
30 Ga0075366_10004614 3300006195 Bacteria 7403
31 Ga0105251_10000008 3300009011 Bacteria 213669
32 Ga0105240_10008300 3300009093 Bacteria 14861
33 Ga0105249_10465433 3300009553 Bacteria 1305
34 Ga0157369_10019608 3300013105 Bacteria 7567
35 Ga0157380_10391693 3300014326 Bacteria 1315
36 Ga0182008_10001051 3300014497 Bacteria 19128
37 Ga0213876_10033906 3300021384 Bacteria 2691
38 Ga0209674_104353 3300025226 Bacteria 2322
39 Ga0209148_1005267 3300025254 Bacteria 3000
40 Ga0209673_1000013 3300025273 Bacteria 571633
41 Ga0209025_1000030 3300025294 Bacteria 441196
42 Ga0209564_1000167 3300025295 Bacteria 159653
43 Ga0209758_1000079 3300025297 Bacteria 262874
44 Ga0209758_1007076 3300025297 Bacteria 7776
45 Ga0209758_1008868 3300025297 Bacteria 6389
46 Ga0209256_1000258 3300025299 Bacteria 94293
47 Ga0207713_1000100 3300025735 Bacteria 140917
48 Ga0207647_10000056 3300025904 Bacteria 86476
49 Ga0207695_10780085 3300025913 Bacteria 836
50 Ga0207663_10514856 3300025916 Bacteria 931
51 Ga0207657_10222820 3300025919 Bacteria 1510
52 Ga0207650_10015381 3300025925 Bacteria 5327
53 Ga0207664_10222703 3300025929 Bacteria 1637
54 Ga0207667_10000040 3300025949 Bacteria 275827
55 Ga0207640_10000009 3300025981 Bacteria 283101
56 Ga0209813_10035548 3300027866 Bacteria 1492
57 Ga0307513_10068726 3300031456 Bacteria 3710
58 Ga0307513_10206163 3300031456 Bacteria 1802
59 Ga0307513_10337464 3300031456 Bacteria 1259
60 Ga0307516_10441003 3300031730 Bacteria 959
61 Ga0395905_0000236 3300037471 Bacteria 83344
62 Ga0436365_0684900 3300039437 Bacteria 28247
63 Ga0466968_0121082 3300044735 Bacteria 1184
64 Ga0466967_0135061 3300045976 Bacteria 2293
65 Ga0495638_0054651 3300046460 Bacteria 2482
66 Ga0495606_0284069 3300046507 Bacteria 903
67 Ga0495610_0002504 3300046512 Bacteria 15353
68 Ga0495622_0027554 3300046557 Bacteria 2652
69 Ga0495670_0017779 3300046691 Bacteria 3501
70 Ga0495649_0000188 3300046694 Bacteria 54294
71 Ga0495672_0091689 3300047320 Bacteria 1667
72 Ga0495686_0002553 3300047472 Bacteria 16996
73 Ga0496100_0062912 3300048903 Bacteria 2451
74 Ga0496101_0029560 3300048904 Bacteria 3833
75 Ga0496102_0299597 3300048905 Bacteria 1515
76 Ga0496104_0062873 3300048907 Bacteria 3520
77 Ga0496108_0635936 3300048911 Bacteria 928
78 Ga0496109_0672878 3300048912 Bacteria 972
79 Ga0496110_0814763 3300048913 Bacteria 838
80 Ga0496112_0332569 3300048915 Bacteria 1463
81 Ga0496113_0115957 3300048916 Bacteria 2090
82 Ga0496115_0169481 3300048918 Bacteria 1806
83 Ga0496115_0521836 3300048918 Bacteria 952
84 Ga0496117_0001767 3300048920 Bacteria 29757
85 Ga0496117_0058725 3300048920 Bacteria 2662
86 Ga0496118_0008099 3300048921 Bacteria 10954
87 Ga0496118_0012401 3300048921 Bacteria 8187
88 Ga0496118_0014451 3300048921 Bacteria 7391
89 Ga0496119_0000328 3300048922 Bacteria 66480
90 Ga0496119_0018825 3300048922 Bacteria 5116
91 Ga0496120_0000244 3300048923 Bacteria 92211
92 Ga0496120_0050829 3300048923 Bacteria 2371
93 Ga0496122_0028737 3300048925 Bacteria 4707
94 Ga0496122_0058598 3300048925 Bacteria 2849
95 Ga0496122_0183066 3300048925 Bacteria 1247
96 Ga0496125_0061262 3300048928 Bacteria 3019
97 Ga0495682_0041646 3300049460 Bacteria 1683
98 Ga0501070_0008578 3300049586 Bacteria 8641
99 Ga0501074_0245403 3300049590 Bacteria 1273
100 Ga0501269_009507 3300049766 Bacteria 1179
101 Ga0501279_000164 3300049775 Bacteria 9396
102 nmdc:mga03n38_19281_c1 3300050490 Bacteria 2708
103 nmdc:mga0k408_1166_c1 3300050493 Bacteria 14367
104 nmdc:mga04h51_6264_c1 3300050495 Bacteria 3076
105 nmdc:mga0rr50_452609_c1 3300050513 Bacteria 1088
106 Ga0500583_0045661 3300053092 Bacteria 2013
107 Ga0500651_0269624 3300053093 Bacteria 985
108 Ga0500566_0009148 3300053094 Bacteria 5857
109 Ga0500641_0029598 3300053096 Bacteria 2147
110 Ga0500641_0093923 3300053096 Bacteria 1282
111 Ga0500660_132822 3300053100 Bacteria 1008
112 Ga0500554_009810 3300053102 Bacteria 2307
113 Ga0500608_000117 3300053122 Bacteria 32871
114 Ga0500618_020127 3300053125 Bacteria 1637
115 Ga0500642_0139911 3300053130 Bacteria 1135
116 Ga0500559_0000161 3300053136 Bacteria 53055
117 Ga0500559_0004616 3300053136 Bacteria 6505
118 Ga0500568_0012141 3300053139 Bacteria 3970
119 Ga0500588_0000409 3300053146 Bacteria 6734
120 Ga0500590_156528 3300053148 Bacteria 1021
121 Ga0500616_0051093 3300053153 Bacteria 2180
122 Ga0500622_0007115 3300053156 Bacteria 6390
123 Ga0500636_0017806 3300053177 Bacteria 4198
124 Ga0500625_136718 3300053729 Bacteria 951
125 2587918917 2585428106 Bacteria 5179711
126 2595448817 2593339238 Bacteria 4182970
127 2738718882 2738541277 Bacteria 7458140
128 2739280900 2738543019 Bacteria 7459457
129 2841762824 2841760612 Bacteria 6454112
130 2842202678 2842198810 Bacteria 6608673
131 2844110168 2844104063 Bacteria 6440972
132 2851251830 2851246043 Bacteria 6439203
133 8056174340 8056172158 Bacteria 6133900
134 Ga0207678_10329301
135 JGI25162J39368_1004726
136 JGI25153J46596_10000884
137 JGI25153J46596_10008104
138 JGI25404J52841_10003705
139 JGI25404J52841_10012967
140 Ga0055526_1001022
141 Ga0055524_1020828
142 Ga0055536_1004031
143 Ga0055528_1000044
144 Ga0055530_10009339
145 Ga0055530_10034242
146 Ga0055531_10001453
147 Ga0070670_100000697
148 Ga0070669_100067743
149 Ga0070659_100005582
150 Ga0070714_100209546
151 Ga0068855_100524251
152 Ga0068854_100000142
153 Ga0081540_1000741
154 Ga0081540_1009972
155 Ga0081539_10006630
156 Ga0075365_10254778
157 Ga0075368_10063948
158 Ga0075364_10030844
159 Ga0075362_10155717
160 Ga0075362_10310909
161 Ga0075367_10143028
162 Ga0075367_10379014
163 Ga0075366_10004614
164 Ga0105251_10000008
165 Ga0105240_10008300
166 Ga0105249_10465433
167 Ga0157369_10019608
168 Ga0157380_10391693
169 Ga0182008_10001051
170 Ga0213876_10033906
171 Ga0209674_104353
172 Ga0209148_1005267
173 Ga0209673_1000013
174 Ga0209025_1000030
175 Ga0209564_1000167
176 Ga0209758_1000079
177 Ga0209758_1007076
178 Ga0209758_1008868
179 Ga0209256_1000258
180 Ga0207713_1000100
181 Ga0207647_10000056
182 Ga0207695_10780085
183 Ga0207663_10514856
184 Ga0207657_10222820
185 Ga0207650_10015381
186 Ga0207664_10222703
187 Ga0207667_10000040
188 Ga0207640_10000009
189 Ga0209813_10035548
190 Ga0307513_10068726
191 Ga0307513_10206163
192 Ga0307513_10337464
193 Ga0307516_10441003
194 Ga0395905_0000236
195 Ga0436365_0684900
196 Ga0466968_0121082
197 Ga0466967_0135061
198 Ga0495638_0054651
199 Ga0495606_0284069
200 Ga0495610_0002504
201 Ga0495622_0027554
202 Ga0495670_0017779
203 Ga0495649_0000188
204 Ga0495672_0091689
205 Ga0495686_0002553
206 Ga0496100_0062912
207 Ga0496101_0029560
208 Ga0496102_0299597
209 Ga0496104_0062873
210 Ga0496108_0635936
211 Ga0496109_0672878
212 Ga0496110_0814763
213 Ga0496112_0332569
214 Ga0496113_0115957
215 Ga0496115_0169481
216 Ga0496115_0521836
217 Ga0496117_0001767
218 Ga0496117_0058725
219 Ga0496118_0008099
220 Ga0496118_0012401
221 Ga0496118_0014451
222 Ga0496119_0000328
223 Ga0496119_0018825
224 Ga0496120_0000244
225 Ga0496120_0050829
226 Ga0496122_0028737
227 Ga0496122_0058598
228 Ga0496122_0183066
229 Ga0496125_0061262
230 Ga0495682_0041646
231 Ga0501070_0008578
232 Ga0501074_0245403
233 Ga0501269_009507
234 Ga0501279_000164
235 nmdc:mga03n38_19281_c1
236 nmdc:mga0k408_1166_c1
237 nmdc:mga04h51_6264_c1
238 nmdc:mga0rr50_452609_c1
239 Ga0500583_0045661
240 Ga0500651_0269624
241 Ga0500566_0009148
242 Ga0500641_0029598
243 Ga0500641_0093923
244 Ga0500660_132822
245 Ga0500554_009810
246 Ga0500608_000117
247 Ga0500618_020127
248 Ga0500642_0139911
249 Ga0500559_0000161
250 Ga0500559_0004616
251 Ga0500568_0012141
252 Ga0500588_0000409
253 Ga0500590_156528
254 Ga0500616_0051093
255 Ga0500622_0007115
256 Ga0500636_0017806
257 Ga0500625_136718
258 2587918917
259 2595448817
260 2738718882
261 2739280900
262 2841762824
263 2842202678
264 2844110168
265 2851251830
266 8056174340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

27

73

0.97

PF17923

TetR_C_18

Tetracyclin repressor-like, C-terminal domain

95

167

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oer-assembly1.cif.gz_A probable transcriptional regulator from pseudomonas aeruginosa 0.9486 22 207
2oer-assembly1.cif.gz_A probable transcriptional regulator from pseudomonas aeruginosa 0.9334 22 207
2oer-assembly1.cif.gz_B probable transcriptional regulator from pseudomonas aeruginosa 0.9181 22 207
2oer-assembly1.cif.gz_B probable transcriptional regulator from pseudomonas aeruginosa 0.8953 22 207
3dcf-assembly1.cif.gz_B crystal structure of transcriptional regulator of the tetr/acrr family (yp_290855.1) from thermobifida fusca yx-er1 at 2.50 a resolution 0.7818 21 205
ID Description Score Start End Superfamily
5gpcB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9538 23 63 1.10.10.60
3whcE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9537 21 65 1.10.10.60
3whcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9534 22 63 1.10.10.60
2oerA00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9482 22 207 1.10.357.10
3mvpB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9435 21 63 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A526QJ51-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9899 25 207 GO:0000976
GO:0003700
AF-A0A530QKZ7-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9774 28 156 GO:0000976
GO:0003700
AF-A0A526QJ51-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9638 25 207 GO:0000976
GO:0003700
AF-A0A530QKZ7-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9212 28 156 GO:0000976
GO:0003700
AF-A0A7W7Z659-F1-model_v4 AcrR family transcriptional regulator 0.9106 25 219 GO:0000976
GO:0003700

Map