F156403

General Info

Members Datasets Scaffolds Average Seq Length
133 84 130 246

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10058665|Ga0182008_100586652
Length 288
Sequence VLDHRRVERLLVSTLRAAPPRAEAIARARVRVEDNAVHDDLSFALELADLADSISLARFRAADLSVETKADATPVSDADRAVEDALRETIAADRPGESVLGEEGGGGESEGPLWVIDPIDGTRNYIRGIPIWATLIALERDDDVVAAVASAPALGHRWWASRGGGAFADGSAIRVSGVRRIEDATFCYTSARSFARAGLGERFLELAARAWVERGFGDFWMHMLVAEGAADVAVDAALQRWDVAAVELIVEEAGGRVTDLNGNRHLAGAPALSTNDALHDAIVAAFAG

Samples

Sample ID Description Type Environment
1 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
27 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
42 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
62 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
66 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
67 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
68 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
69 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
70 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
71 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
72 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
76 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
81 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
82 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
83 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
84 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.04
Rhizosphere 81.95
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10181688 3300005327 Bacteria 1770
2 Ga0070683_100642123 3300005329 Bacteria 1016
3 Ga0070680_100026349 3300005336 Bacteria 4650
4 Ga0070661_100026121 3300005344 Bacteria 4197
5 Ga0070714_100018345 3300005435 Bacteria 5683
6 Ga0070714_100030117 3300005435 Bacteria 4516
7 Ga0070714_100316789 3300005435 Bacteria 1458
8 Ga0070714_100367961 3300005435 Bacteria 1353
9 Ga0070714_100528118 3300005435 Bacteria 1128
10 Ga0070713_100298255 3300005436 Bacteria 1483
11 Ga0070713_100853916 3300005436 Bacteria 874
12 Ga0070708_100007486 3300005445 Bacteria 8742
13 Ga0070708_100422235 3300005445 Bacteria 1258
14 Ga0070681_10025754 3300005458 Bacteria 5914
15 Ga0070681_10324532 3300005458 Bacteria 1449
16 Ga0070707_100211388 3300005468 Bacteria 1891
17 Ga0070698_100141509 3300005471 Bacteria 2357
18 Ga0070679_100004535 3300005530 Bacteria 12827
19 Ga0070679_100058362 3300005530 Bacteria 3845
20 Ga0070684_100325455 3300005535 Bacteria 1412
21 Ga0068853_100043582 3300005539 Bacteria 3838
22 Ga0068856_100205861 3300005614 Bacteria 1982
23 Ga0068856_100278917 3300005614 Bacteria 1688
24 Ga0081455_10023242 3300005937 Bacteria 5774
25 Ga0081539_10001337 3300005985 Bacteria 42952
26 Ga0081539_10003814 3300005985 Bacteria 17718
27 Ga0075431_100003304 3300006847 Bacteria 15617
28 Ga0114129_10097078 3300009147 Bacteria 4079
29 Ga0105242_10134787 3300009176 Bacteria 2136
30 Ga0105239_10455550 3300010375 Bacteria 1451
31 Ga0157370_10079354 3300013104 Bacteria 3091
32 Ga0157369_10022753 3300013105 Bacteria 6988
33 Ga0157372_10085970 3300013307 Bacteria 3568
34 Ga0157372_11252523 3300013307 Bacteria 856
35 Ga0182008_10004854 3300014497 Bacteria 7768
36 Ga0182008_10058665 3300014497 Bacteria 1899
37 Ga0182008_10248776 3300014497 Bacteria 916
38 Ga0182006_1029801 3300015261 Bacteria 2209
39 Ga0213876_10018310 3300021384 Bacteria 3698
40 Ga0207705_10119156 3300025909 Bacteria 1957
41 Ga0207705_10357747 3300025909 Bacteria 1125
42 Ga0207707_10006008 3300025912 Bacteria 10625
43 Ga0207707_10021660 3300025912 Bacteria 5617
44 Ga0207707_10245400 3300025912 Bacteria 1556
45 Ga0207660_10005845 3300025917 Bacteria 7984
46 Ga0207660_10733849 3300025917 Bacteria 806
47 Ga0207657_10523294 3300025919 Bacteria 928
48 Ga0207649_10093004 3300025920 Bacteria 1978
49 Ga0207652_10009276 3300025921 Bacteria 7912
50 Ga0207652_10277871 3300025921 Bacteria 1511
51 Ga0207646_10104487 3300025922 Bacteria 2540
52 Ga0207646_10294248 3300025922 Bacteria 1467
53 Ga0207664_10048335 3300025929 Bacteria 3345
54 Ga0207661_10193579 3300025944 Bacteria 1784
55 Ga0207667_10510401 3300025949 Bacteria 1219
56 Ga0207702_10067289 3300026078 Bacteria 3074
57 Ga0207702_10202121 3300026078 Bacteria 1842
58 Ga0265334_10027869 3300028573 Bacteria 2273
59 Ga0265338_10011967 3300028800 Bacteria 9940
60 Ga0265324_10096577 3300029957 Bacteria 1005
61 Ga0265332_10115250 3300031238 Bacteria 1130
62 Ga0265320_10003043 3300031240 Bacteria 11385
63 Ga0265325_10175005 3300031241 Bacteria 1002
64 Ga0265339_10054550 3300031249 Bacteria 2170
65 Ga0265331_10021450 3300031250 Bacteria 3306
66 Ga0265327_10022019 3300031251 Bacteria 3827
67 Ga0265316_10019611 3300031344 Bacteria 5777
68 Ga0265313_10027547 3300031595 Bacteria 2972
69 Ga0265313_10045270 3300031595 Bacteria 2143
70 Ga0265314_10019610 3300031711 Bacteria 5236
71 Ga0265314_10049765 3300031711 Bacteria 2931
72 Ga0265342_10072855 3300031712 Bacteria 1999
73 Ga0373934_0085246 3300035086 Bacteria 1271
74 Ga0395899_0383332 3300037312 Bacteria 934
75 Ga0395900_0031697 3300037418 Bacteria 5433
76 Ga0395900_0034420 3300037418 Bacteria 5216
77 Ga0395900_0045019 3300037418 Bacteria 4545
78 Ga0395900_0408933 3300037418 Bacteria 1320
79 Ga0395898_0051443 3300037466 Bacteria 4028
80 Ga0395898_0069235 3300037466 Bacteria 3414
81 Ga0395898_0094800 3300037466 Bacteria 2868
82 Ga0395898_0214241 3300037466 Bacteria 1837
83 Ga0395898_0284971 3300037466 Bacteria 1576
84 Ga0395905_0024258 3300037471 Bacteria 5725
85 Ga0436364_1216397 3300037853 Bacteria 1456
86 Ga0395901_0029189 3300038443 Bacteria 5676
87 Ga0395901_0114314 3300038443 Bacteria 2835
88 Ga0395901_0164302 3300038443 Bacteria 2331
89 Ga0395901_0176593 3300038443 Bacteria 2240
90 Ga0395901_0714676 3300038443 Bacteria 998
91 Ga0436365_0319636 3300039437 Bacteria 3456
92 Ga0436365_1073940 3300039437 Bacteria 5272
93 Ga0466963_0017575 3300044694 Bacteria 4460
94 Ga0466957_0024945 3300044842 Bacteria 3542
95 Ga0466960_0029723 3300044901 Bacteria 2510
96 Ga0466958_0004552 3300045836 Bacteria 7332
97 Ga0466958_0076189 3300045836 Bacteria 2059
98 Ga0466967_0002743 3300045976 Bacteria 11137
99 Ga0466967_0013433 3300045976 Bacteria 6326
100 Ga0466967_0020800 3300045976 Bacteria 5314
101 Ga0466967_0028772 3300045976 Bacteria 4644
102 Ga0466967_0175700 3300045976 Bacteria 2017
103 Ga0466967_0299407 3300045976 Bacteria 1547
104 Ga0495620_0005575 3300046515 Bacteria 7015
105 Ga0495674_0448519 3300047319 Bacteria 1037
106 Ga0496101_0005324 3300048904 Bacteria 8194
107 Ga0496102_0182075 3300048905 Unclassified 1980
108 Ga0496104_0047688 3300048907 Bacteria 4038
109 Ga0496104_0190454 3300048907 Bacteria 1962
110 Ga0496104_0780781 3300048907 Bacteria 862
111 Ga0496106_0000350 3300048909 Bacteria 32656
112 Ga0496107_0005082 3300048910 Bacteria 8968
113 Ga0496107_0006708 3300048910 Bacteria 7927
114 Ga0496108_0004980 3300048911 Bacteria 10735
115 Ga0496108_0067617 3300048911 Bacteria 3014
116 Ga0496109_0059878 3300048912 Bacteria 3479
117 Ga0496110_0016081 3300048913 Bacteria 6239
118 Ga0496110_0031407 3300048913 Bacteria 4583
119 Ga0496110_0181692 3300048913 Bacteria 1910
120 Ga0496112_0005941 3300048915 Bacteria 10649
121 Ga0496112_0326617 3300048915 Bacteria 1478
122 Ga0496112_0522455 3300048915 Bacteria 1122
123 Ga0496112_0533270 3300048915 Bacteria 1108
124 Ga0496113_0379236 3300048916 Bacteria 1135
125 Ga0496114_0025147 3300048917 Bacteria 4864
126 Ga0501067_0029402 3300049583 Bacteria 3045
127 Ga0501070_0466204 3300049586 Bacteria 1017
128 nmdc:mga05p37_41528_c1 3300050507 Bacteria 5647
129 nmdc:mga06r32_2753_c1 3300050510 Bacteria 15735
130 Ga0466962_0108134 3300061719 Bacteria 1338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0176593 Ga0395901_0176593_11_613 178
2 3300005445 Ga0070708_100422235 Ga0070708_1004222353 198
3 3300045976 Ga0466967_0002743 Ga0466967_0002743_949_1599 198
4 3300045976 Ga0466967_0028772 Ga0466967_0028772_453_1109 200
5 3300005329 Ga0070683_100642123 Ga0070683_1006421232 211
6 3300005336 Ga0070680_100026349 Ga0070680_1000263492 211
7 3300005344 Ga0070661_100026121 Ga0070661_1000261212 211
8 3300005458 Ga0070681_10025754 Ga0070681_100257544 211
9 3300005530 Ga0070679_100004535 Ga0070679_1000045356 211
10 3300005535 Ga0070684_100325455 Ga0070684_1003254552 211
11 3300005539 Ga0068853_100043582 Ga0068853_1000435825 211
12 3300013307 Ga0157372_10085970 Ga0157372_100859702 211
13 3300025912 Ga0207707_10006008 Ga0207707_100060089 211
14 3300025917 Ga0207660_10005845 Ga0207660_100058452 211
15 3300025919 Ga0207657_10523294 Ga0207657_105232941 211
16 3300025920 Ga0207649_10093004 Ga0207649_100930042 211
17 3300025921 Ga0207652_10009276 Ga0207652_100092766 211
18 3300025944 Ga0207661_10193579 Ga0207661_101935792 211
19 3300037418 Ga0395900_0031697 Ga0395900_0031697_2980_3735 213
20 3300037466 Ga0395898_0069235 Ga0395898_0069235_268_1023 213
21 3300037471 Ga0395905_0024258 Ga0395905_0024258_611_1366 213
22 3300038443 Ga0395901_0029189 Ga0395901_0029189_2476_3231 213
23 3300005435 Ga0070714_100316789 Ga0070714_1003167891 214
24 3300005985 Ga0081539_10003814 Ga0081539_1000381417 215
25 3300021384 Ga0213876_10018310 Ga0213876_100183102 215
26 3300039437 Ga0436365_0319636 Ga0436365_0319636_2507_3259 215
27 3300005436 Ga0070713_100853916 Ga0070713_1008539161 216
28 3300005468 Ga0070707_100211388 Ga0070707_1002113882 216
29 3300009147 Ga0114129_10097078 Ga0114129_100970783 216
30 3300009176 Ga0105242_10134787 Ga0105242_101347872 216
31 3300010375 Ga0105239_10455550 Ga0105239_104555502 216
32 3300014497 Ga0182008_10248776 Ga0182008_102487761 216
33 3300025922 Ga0207646_10104487 Ga0207646_101044873 216
34 3300025922 Ga0207646_10294248 Ga0207646_102942482 216
35 3300035086 Ga0373934_0085246 Ga0373934_0085246_467_1201 216
36 3300037418 Ga0395900_0034420 Ga0395900_0034420_542_1264 216
37 3300037418 Ga0395900_0045019 Ga0395900_0045019_1052_1768 216
38 3300037466 Ga0395898_0214241 Ga0395898_0214241_710_1432 216
39 3300045976 Ga0466967_0013433 Ga0466967_0013433_4079_4786 216
40 3300050507 nmdc:mga05p37_41528_c1 nmdc:mga05p37_41528_c1_4775_5551 216
41 3300005435 Ga0070714_100018345 Ga0070714_1000183453 217
42 3300005435 Ga0070714_100030117 Ga0070714_1000301174 217
43 3300005614 Ga0068856_100278917 Ga0068856_1002789172 217
44 3300013104 Ga0157370_10079354 Ga0157370_100793543 217
45 3300013105 Ga0157369_10022753 Ga0157369_100227532 217
46 3300013307 Ga0157372_11252523 Ga0157372_112525232 217
47 3300025949 Ga0207667_10510401 Ga0207667_105104012 217
48 3300026078 Ga0207702_10202121 Ga0207702_102021212 217
49 3300031250 Ga0265331_10021450 Ga0265331_100214502 217
50 3300031595 Ga0265313_10027547 Ga0265313_100275472 217
51 3300038443 Ga0395901_0714676 Ga0395901_0714676_175_903 217
52 3300005985 Ga0081539_10001337 Ga0081539_1000133729 218
53 3300006847 Ga0075431_100003304 Ga0075431_1000033042 218
54 3300031249 Ga0265339_10054550 Ga0265339_100545503 218
55 3300031595 Ga0265313_10045270 Ga0265313_100452702 218
56 3300031711 Ga0265314_10019610 Ga0265314_100196105 218
57 3300031712 Ga0265342_10072855 Ga0265342_100728552 218
58 3300037466 Ga0395898_0051443 Ga0395898_0051443_1674_2387 218
59 3300037853 Ga0436364_1216397 Ga0436364_1216397_399_1160 218
60 3300038443 Ga0395901_0164302 Ga0395901_0164302_634_1347 218
61 3300039437 Ga0436365_1073940 Ga0436365_1073940_164_925 218
62 3300046515 Ga0495620_0005575 Ga0495620_0005575_5946_6701 218
63 3300050510 nmdc:mga06r32_2753_c1 nmdc:mga06r32_2753_c1_14558_15313 218
64 3300005435 Ga0070714_100367961 Ga0070714_1003679612 219
65 3300005436 Ga0070713_100298255 Ga0070713_1002982551 219
66 3300005471 Ga0070698_100141509 Ga0070698_1001415092 219
67 3300014497 Ga0182008_10004854 Ga0182008_100048546 219
68 3300014497 Ga0182008_10058665 Ga0182008_100586652 219
69 3300015261 Ga0182006_1029801 Ga0182006_10298012 219
70 3300025909 Ga0207705_10357747 Ga0207705_103577471 219
71 3300037312 Ga0395899_0383332 Ga0395899_0383332_69_824 219
72 3300037418 Ga0395900_0408933 Ga0395900_0408933_373_1128 219
73 3300037466 Ga0395898_0094800 Ga0395898_0094800_380_1135 219
74 3300037466 Ga0395898_0284971 Ga0395898_0284971_222_977 219
75 3300038443 Ga0395901_0114314 Ga0395901_0114314_1098_1832 219
76 3300044694 Ga0466963_0017575 Ga0466963_0017575_133_873 219
77 3300044901 Ga0466960_0029723 Ga0466960_0029723_1450_2178 219
78 3300045836 Ga0466958_0004552 Ga0466958_0004552_501_1241 219
79 3300045836 Ga0466958_0076189 Ga0466958_0076189_523_1254 219
80 3300045976 Ga0466967_0020800 Ga0466967_0020800_3064_3804 219
81 3300045976 Ga0466967_0175700 Ga0466967_0175700_1040_1780 219
82 3300045976 Ga0466967_0299407 Ga0466967_0299407_176_916 219
83 3300048907 Ga0496104_0047688 Ga0496104_0047688_1958_2785 219
84 3300048913 Ga0496110_0031407 Ga0496110_0031407_265_1092 219
85 3300049583 Ga0501067_0029402 Ga0501067_0029402_148_888 219
86 3300049586 Ga0501070_0466204 Ga0501070_0466204_238_978 219
87 3300005435 Ga0070714_100528118 Ga0070714_1005281182 220
88 3300005937 Ga0081455_10023242 Ga0081455_100232424 220
89 3300025912 Ga0207707_10021660 Ga0207707_100216604 220
90 3300025917 Ga0207660_10733849 Ga0207660_107338491 220
91 3300025929 Ga0207664_10048335 Ga0207664_100483352 220
92 3300028573 Ga0265334_10027869 Ga0265334_100278692 220
93 3300028800 Ga0265338_10011967 Ga0265338_100119672 220
94 3300029957 Ga0265324_10096577 Ga0265324_100965772 220
95 3300031238 Ga0265332_10115250 Ga0265332_101152502 220
96 3300031240 Ga0265320_10003043 Ga0265320_100030433 220
97 3300031241 Ga0265325_10175005 Ga0265325_101750052 220
98 3300031251 Ga0265327_10022019 Ga0265327_100220193 220
99 3300031344 Ga0265316_10019611 Ga0265316_100196112 220
100 3300031711 Ga0265314_10049765 Ga0265314_100497652 220
101 3300047319 Ga0495674_0448519 Ga0495674_0448519_245_976 220
102 3300048904 Ga0496101_0005324 Ga0496101_0005324_3179_3913 220
103 3300048905 Ga0496102_0182075 Ga0496102_0182075_655_1389 220
104 3300048907 Ga0496104_0780781 Ga0496104_0780781_46_780 220
105 3300048910 Ga0496107_0006708 Ga0496107_0006708_4721_5455 220
106 3300048911 Ga0496108_0004980 Ga0496108_0004980_4292_5026 220
107 3300048913 Ga0496110_0016081 Ga0496110_0016081_370_1104 220
108 3300048915 Ga0496112_0005941 Ga0496112_0005941_1303_2037 220
109 3300048915 Ga0496112_0522455 Ga0496112_0522455_301_1035 220
110 3300048917 Ga0496114_0025147 Ga0496114_0025147_2128_2862 220
111 iso_pu_bacteria 2995726249 2995727491 220
112 3300005327 Ga0070658_10181688 Ga0070658_101816883 221
113 3300005445 Ga0070708_100007486 Ga0070708_1000074865 221
114 3300005458 Ga0070681_10324532 Ga0070681_103245322 221
115 3300005530 Ga0070679_100058362 Ga0070679_1000583622 221
116 3300005614 Ga0068856_100205861 Ga0068856_1002058612 221
117 3300025909 Ga0207705_10119156 Ga0207705_101191563 221
118 3300025912 Ga0207707_10245400 Ga0207707_102454002 221
119 3300025921 Ga0207652_10277871 Ga0207652_102778711 221
120 3300026078 Ga0207702_10067289 Ga0207702_100672892 221
121 3300044842 Ga0466957_0024945 Ga0466957_0024945_1455_2213 221
122 3300048907 Ga0496104_0190454 Ga0496104_0190454_1047_1787 221
123 3300048909 Ga0496106_0000350 Ga0496106_0000350_21275_22021 221
124 3300048910 Ga0496107_0005082 Ga0496107_0005082_7484_8230 221
125 3300048911 Ga0496108_0067617 Ga0496108_0067617_1309_2049 221
126 3300048912 Ga0496109_0059878 Ga0496109_0059878_878_1618 221
127 3300048913 Ga0496110_0181692 Ga0496110_0181692_628_1368 221
128 3300048915 Ga0496112_0326617 Ga0496112_0326617_668_1414 221
129 3300048915 Ga0496112_0533270 Ga0496112_0533270_256_996 221
130 3300048916 Ga0496113_0379236 Ga0496113_0379236_103_843 221
131 3300061719 Ga0466962_0108134 Ga0466962_0108134_53_811 221
132 iso_pu_bacteria 8055034563 8055035559 221
133 iso_pu_bacteria 8055037949 8055038032 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

37

287

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ib8-assembly1.cif.gz_B structure of a complex of suhb and nusa ar2 domain 0.8762 1 219
2p3v-assembly1.cif.gz_A thermotoga maritima impase tm1415 0.8707 2 219
3lv0-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, native 0.8662 2 221
6ib8-assembly1.cif.gz_B structure of a complex of suhb and nusa ar2 domain 0.865 1 219
3lv0-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, native 0.8589 2 221
ID Description Score Start End Superfamily
af_P95189_1_144_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8818 4 135 3.30.540.10
2pcrB01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8676 5 136 3.30.540.10
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8617 5 136 3.30.540.10
af_Q6F2U7_1_143_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8527 5 134 3.30.540.10
af_P22255_1_146_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.851 5 139 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A1T4XB89-F1-model_v4 Histidinol-phosphatase (EC 3.1.3.15) 0.9131 2 217 GO:0000105
GO:0004401
GO:0006020
GO:0007165
GO:0008934
GO:0046872
AF-A0A6G8FKR6-F1-model_v4 Histidinol phosphatase 0.9128 1 219 GO:0000105
GO:0016791
GO:0046872
AF-A0A6J7P8T3-F1-model_v4 histidinol-phosphatase (EC 3.1.3.15) (Histidinol-phosphate phosphatase) 0.9107 1 217 GO:0000105
GO:0004401
GO:0006020
GO:0007165
GO:0008934
GO:0046872
AF-A0A4R7HWN4-F1-model_v4 Histidinol-phosphatase 0.9096 1 217 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A6P1EZN0-F1-model_v4 Histidinol phosphatase 0.9065 4 217 GO:0000105
GO:0016791
GO:0046872

Feature Viewer

pLDDT pTM Quality
87.51 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map