F155892

General Info

Members Datasets Scaffolds Average Seq Length
133 88 121 263

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100109345|Ga0070712_1001093452
Length 295
Sequence VPQSMENKANTISTTAATNRQFQFALKLIFSPTMSDSIEVLQQYRNGKPRVGVYGSAATAGRAAAVQAARIIQRAIAEQGRARVIAATGNSQIPVADALVEQDIDWKAVELFHMDEYAGIKPDHPSSFRYWIRTRLEEKVHPGVAHYLEGDASDLSAEMNRYSQLLKAAPIDLAFVGFGENGHIAFNDPPVADFXXXAMVKIITLDDACRRQQAGEGHFRDVASVPKEAATITCTGLFRAKSWICCVPEQRKAEAVRNALEGPVSEACPASLVRRHPDAFVFLDRDSASQLSYEK

Samples

Sample ID Description Type Environment
1 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
2 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
3 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
4 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
5 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
6 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
7 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
8 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
9 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
83 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
85 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
88 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.47
Metatranscriptomes 1.5
Isolates 9.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0.75
Rhizoplane 3.01
Rhizosphere 78.2
Stem 0
Stem Tuber 0
Unclassified 15.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10164433 3300003320 Bacteria 3266
2 rootH2_10183921 3300003320 Bacteria 2907
3 Ga0055538_1000667 3300003751 Bacteria 10729
4 Ga0070683_100061620 3300005329 Unclassified 3488
5 Ga0070660_100170490 3300005339 Bacteria 1758
6 Ga0070661_100052021 3300005344 Bacteria 2998
7 Ga0070661_100077362 3300005344 Bacteria 2453
8 Ga0070659_100088707 3300005366 Bacteria 2477
9 Ga0070659_100150799 3300005366 Bacteria 1896
10 Ga0070711_100268947 3300005439 Unclassified 1344
11 Ga0070708_100074694 3300005445 Bacteria 3058
12 Ga0070678_100185862 3300005456 Bacteria 1705
13 Ga0070681_10443482 3300005458 Bacteria 1210
14 Ga0070706_100009394 3300005467 Bacteria 9105
15 Ga0070679_100540890 3300005530 Bacteria 1108
16 Ga0070684_100386513 3300005535 Bacteria 1289
17 Ga0070665_100165147 3300005548 Unclassified 2216
18 Ga0068854_100262875 3300005578 Bacteria 1382
19 Ga0068856_100006560 3300005614 Bacteria 11409
20 Ga0068856_100012572 3300005614 Bacteria 8195
21 Ga0068856_100079398 3300005614 Unclassified 3254
22 Ga0068856_100348543 3300005614 Bacteria 1499
23 Ga0068859_100173919 3300005617 Unclassified 2235
24 Ga0081455_10016258 3300005937 Bacteria 7189
25 Ga0070717_10158995 3300006028 Bacteria 1959
26 Ga0070717_10253257 3300006028 Bacteria 1556
27 Ga0070712_100109345 3300006175 Unclassified 2060
28 Ga0068871_100111395 3300006358 Bacteria 2302
29 Ga0075428_100091644 3300006844 Bacteria 3315
30 Ga0097620_100173919 3300006931 Unclassified 2235
31 Ga0105240_10011467 3300009093 Bacteria 12344
32 Ga0105241_10070646 3300009174 Bacteria 2709
33 Ga0105248_10365209 3300009177 Bacteria 1625
34 Ga0105248_10420923 3300009177 Bacteria 1504
35 Ga0105248_10449906 3300009177 Bacteria 1451
36 Ga0105237_10120454 3300009545 Unclassified 2618
37 Ga0105238_10046551 3300009551 Unclassified 4376
38 Ga0105239_10350444 3300010375 Unclassified 1667
39 Ga0105239_10610969 3300010375 Bacteria 1244
40 Ga0157373_10086461 3300013100 Bacteria 2210
41 Ga0157371_10014448 3300013102 Bacteria 5957
42 Ga0157370_10030854 3300013104 Bacteria 5250
43 Ga0157370_10062278 3300013104 Unclassified 3538
44 Ga0157370_10079486 3300013104 Bacteria 3088
45 Ga0157370_10608611 3300013104 Unclassified 1000
46 Ga0157369_10000399 3300013105 Bacteria 57828
47 Ga0157369_10024424 3300013105 Bacteria 6723
48 Ga0157369_10033083 3300013105 Bacteria 5684
49 Ga0157369_10063728 3300013105 Bacteria 3971
50 Ga0157369_10971435 3300013105 Bacteria 870
51 Ga0157374_10005283 3300013296 Bacteria 10841
52 Ga0157374_10026490 3300013296 Bacteria 5217
53 Ga0157374_10038825 3300013296 Bacteria 4378
54 Ga0157378_10077668 3300013297 Bacteria 2993
55 Ga0157372_10373089 3300013307 Bacteria 1662
56 Ga0157372_10532334 3300013307 Unclassified 1369
57 Ga0157372_10550398 3300013307 Bacteria 1345
58 Ga0157372_10666149 3300013307 Bacteria 1212
59 Ga0157372_10772194 3300013307 Bacteria 1117
60 Ga0157375_10388053 3300013308 Unclassified 1563
61 Ga0163163_10098305 3300014325 Bacteria 2948
62 Ga0163163_10113160 3300014325 Unclassified 2744
63 Ga0163163_10142573 3300014325 Bacteria 2439
64 Ga0163163_10233360 3300014325 Bacteria 1889
65 Ga0213874_10007996 3300021377 Bacteria 2561
66 Ga0213875_10000044 3300021388 Bacteria 151004
67 Ga0213875_10140091 3300021388 Unclassified 1132
68 Ga0209784_100109 3300025224 Bacteria 93449
69 Ga0209566_111197 3300025225 Bacteria 884
70 Ga0207684_10011388 3300025910 Bacteria 7783
71 Ga0207654_10252147 3300025911 Unclassified 1183
72 Ga0207695_10016444 3300025913 Bacteria 8655
73 Ga0207649_10350181 3300025920 Unclassified 1093
74 Ga0207652_10213948 3300025921 Bacteria 1736
75 Ga0207646_10012687 3300025922 Bacteria 8088
76 Ga0207690_10116974 3300025932 Bacteria 1929
77 Ga0207667_10349135 3300025949 Unclassified 1509
78 Ga0207640_10526829 3300025981 Unclassified 989
79 Ga0207702_10087880 3300026078 Unclassified 2715
80 Ga0207702_10102833 3300026078 Bacteria 2526
81 Ga0207702_10607080 3300026078 Bacteria 1074
82 Ga0207683_10251143 3300026121 Bacteria 1614
83 Ga0268266_10131867 3300028379 Unclassified 2236
84 Ga0373946_0083406 3300035171 Bacteria 1404
85 Ga0373925_0055154 3300037068 Bacteria 2974
86 Ga0436364_0113968 3300037853 Bacteria 1764
87 Ga0436364_0191784 3300037853 Bacteria 8079
88 Ga0436364_0455950 3300037853 Unclassified 2507
89 Ga0436364_0745557 3300037853 Bacteria 199469
90 Ga0395901_0327692 3300038443 Bacteria 1584
91 Ga0436365_0902199 3300039437 Bacteria 1503
92 Ga0436363_0545213 3300039450 Unclassified 1303
93 Ga0436363_0847316 3300039450 Bacteria 1647
94 Ga0436363_1257478 3300039450 Bacteria 3589
95 Ga0436362_0399414 3300039453 Bacteria 2758
96 Ga0453683_0261080 3300044673 Unclassified 1105
97 Ga0453684_0413044 3300044712 Bacteria 1509
98 Ga0495643_0000208 3300046522 Bacteria 90476
99 Ga0496112_0005097 3300048915 Bacteria 11289
100 Ga0496112_0143000 3300048915 Bacteria 2361
101 Ga0496113_0129743 3300048916 Bacteria 1977
102 Ga0496115_0021188 3300048918 Bacteria 5018
103 Ga0501033_0132423 3300049570 Bacteria 1806
104 Ga0501034_0005780 3300049571 Bacteria 13454
105 Ga0501034_0163529 3300049571 Bacteria 2195
106 Ga0501046_0000233 3300049580 Bacteria 57393
107 Ga0501046_0175383 3300049580 Bacteria 1606
108 Ga0501047_0001519 3300049581 Bacteria 22666
109 Ga0501047_0016123 3300049581 Bacteria 7127
110 Ga0501047_0124895 3300049581 Bacteria 2454
111 Ga0501070_0047673 3300049586 Unclassified 3560
112 Ga0501070_0050480 3300049586 Bacteria 3454
113 Ga0501073_0105978 3300049589 Bacteria 1951
114 Ga0501035_0010559 3300049822 Bacteria 8557
115 Ga0501035_0057335 3300049822 Bacteria 3473
116 Ga0501035_0204035 3300049822 Bacteria 1694
117 Ga0501044_0002307 3300049823 Bacteria 21740
118 Ga0501044_0002458 3300049823 Bacteria 21124
119 Ga0501044_0026855 3300049823 Bacteria 6093
120 Ga0587082_007733 3300059504 Bacteria 1475
121 Ga0587083_0009491 3300059505 Bacteria 1552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10024424 Ga0157369_100244243 234
2 3300044673 Ga0453683_0261080 Ga0453683_0261080_320_1090 240
3 3300013105 Ga0157369_10971435 Ga0157369_109714351 241
4 3300005614 Ga0068856_100348543 Ga0068856_1003485431 242
5 3300026078 Ga0207702_10607080 Ga0207702_106070801 242
6 3300037853 Ga0436364_0113968 Ga0436364_0113968_67_804 242
7 3300044712 Ga0453684_0413044 Ga0453684_0413044_302_1054 243
8 3300010375 Ga0105239_10610969 Ga0105239_106109692 244
9 3300049571 Ga0501034_0163529 Ga0501034_0163529_173_931 245
10 iso_pu_bacteria 2904755435 2904756074 248
11 3300009177 Ga0105248_10420923 Ga0105248_104209232 249
12 3300009177 Ga0105248_10449906 Ga0105248_104499062 249
13 3300013308 Ga0157375_10388053 Ga0157375_103880531 249
14 3300014325 Ga0163163_10233360 Ga0163163_102333602 249
15 3300037853 Ga0436364_0455950 Ga0436364_0455950_1117_1920 249
16 3300046522 Ga0495643_0000208 Ga0495643_0000208_3132_3893 250
17 3300049580 Ga0501046_0000233 Ga0501046_0000233_9290_10048 250
18 3300049581 Ga0501047_0001519 Ga0501047_0001519_6758_7516 250
19 3300009177 Ga0105248_10365209 Ga0105248_103652091 251
20 3300013297 Ga0157378_10077668 Ga0157378_100776682 251
21 3300014325 Ga0163163_10113160 Ga0163163_101131603 251
22 iso_pu_bacteria 8054795415 8054798627 251
23 3300009093 Ga0105240_10011467 Ga0105240_1001146712 252
24 3300009545 Ga0105237_10120454 Ga0105237_101204542 252
25 3300009551 Ga0105238_10046551 Ga0105238_100465513 252
26 3300010375 Ga0105239_10350444 Ga0105239_103504441 252
27 3300021377 Ga0213874_10007996 Ga0213874_100079963 252
28 3300025913 Ga0207695_10016444 Ga0207695_100164442 252
29 3300039450 Ga0436363_0847316 Ga0436363_0847316_183_989 252
30 3300039450 Ga0436363_1257478 Ga0436363_1257478_320_1114 252
31 iso_pu_bacteria 2925326138 2925326579 252
32 iso_pu_bacteria 2971403814 2971404384 252
33 3300013105 Ga0157369_10063728 Ga0157369_100637283 253
34 3300049822 Ga0501035_0057335 Ga0501035_0057335_192_1010 254
35 3300049823 Ga0501044_0002307 Ga0501044_0002307_16899_17717 254
36 iso_pu_bacteria 2593339198 2595315979 254
37 iso_pu_bacteria 2821111986 2821114918 254
38 iso_pu_bacteria 2885526491 2885530808 254
39 iso_pu_bacteria 2904162308 2904162976 254
40 3300005344 Ga0070661_100052021 Ga0070661_1000520213 255
41 3300005445 Ga0070708_100074694 Ga0070708_1000746944 255
42 3300005467 Ga0070706_100009394 Ga0070706_1000093948 255
43 3300005617 Ga0068859_100173919 Ga0068859_1001739193 255
44 3300006931 Ga0097620_100173919 Ga0097620_1001739191 255
45 3300013104 Ga0157370_10030854 Ga0157370_100308542 255
46 3300013307 Ga0157372_10373089 Ga0157372_103730892 255
47 3300014325 Ga0163163_10098305 Ga0163163_100983053 255
48 3300025910 Ga0207684_10011388 Ga0207684_100113886 255
49 3300025922 Ga0207646_10012687 Ga0207646_100126879 255
50 iso_pu_bacteria 2857453340 2857455786 255
51 iso_pu_bacteria 2904755435 2904760504 255
52 iso_pu_bacteria 2971410472 2971411377 255
53 iso_pu_bacteria 8056533031 8056535195 255
54 3300003320 rootH2_10183921 rootH2_101839213 257
55 3300025225 Ga0209566_111197 Ga0209566_1111971 257
56 3300005344 Ga0070661_100077362 Ga0070661_1000773621 258
57 3300005366 Ga0070659_100088707 Ga0070659_1000887072 258
58 3300005439 Ga0070711_100268947 Ga0070711_1002689471 258
59 3300005456 Ga0070678_100185862 Ga0070678_1001858622 258
60 3300005548 Ga0070665_100165147 Ga0070665_1001651472 258
61 3300005578 Ga0068854_100262875 Ga0068854_1002628751 258
62 3300005937 Ga0081455_10016258 Ga0081455_100162584 258
63 3300006028 Ga0070717_10253257 Ga0070717_102532572 258
64 3300006358 Ga0068871_100111395 Ga0068871_1001113951 258
65 3300009174 Ga0105241_10070646 Ga0105241_100706462 258
66 3300013104 Ga0157370_10608611 Ga0157370_106086112 258
67 3300013105 Ga0157369_10000399 Ga0157369_100003998 258
68 3300013105 Ga0157369_10033083 Ga0157369_100330835 258
69 3300013296 Ga0157374_10005283 Ga0157374_100052838 258
70 3300013307 Ga0157372_10772194 Ga0157372_107721942 258
71 3300021388 Ga0213875_10000044 Ga0213875_1000004473 258
72 3300021388 Ga0213875_10140091 Ga0213875_101400911 258
73 3300025911 Ga0207654_10252147 Ga0207654_102521471 258
74 3300025920 Ga0207649_10350181 Ga0207649_103501811 258
75 3300025949 Ga0207667_10349135 Ga0207667_103491351 258
76 3300025981 Ga0207640_10526829 Ga0207640_105268292 258
77 3300026121 Ga0207683_10251143 Ga0207683_102511431 258
78 3300028379 Ga0268266_10131867 Ga0268266_101318672 258
79 3300035171 Ga0373946_0083406 Ga0373946_0083406_530_1339 258
80 3300037068 Ga0373925_0055154 Ga0373925_0055154_973_1782 258
81 3300037853 Ga0436364_0745557 Ga0436364_0745557_80655_81470 258
82 3300048918 Ga0496115_0021188 Ga0496115_0021188_1609_2391 258
83 3300005329 Ga0070683_100061620 Ga0070683_1000616201 259
84 3300005530 Ga0070679_100540890 Ga0070679_1005408901 259
85 3300005614 Ga0068856_100012572 Ga0068856_1000125722 259
86 3300005614 Ga0068856_100079398 Ga0068856_1000793982 259
87 3300006028 Ga0070717_10158995 Ga0070717_101589952 259
88 3300013100 Ga0157373_10086461 Ga0157373_100864613 259
89 3300013104 Ga0157370_10062278 Ga0157370_100622783 259
90 3300013296 Ga0157374_10026490 Ga0157374_100264904 259
91 3300013307 Ga0157372_10532334 Ga0157372_105323342 259
92 3300013307 Ga0157372_10666149 Ga0157372_106661492 259
93 3300014325 Ga0163163_10142573 Ga0163163_101425731 259
94 3300026078 Ga0207702_10087880 Ga0207702_100878802 259
95 3300026078 Ga0207702_10102833 Ga0207702_101028332 259
96 3300037853 Ga0436364_0191784 Ga0436364_0191784_3788_4591 259
97 3300038443 Ga0395901_0327692 Ga0395901_0327692_422_1231 259
98 3300039450 Ga0436363_0545213 Ga0436363_0545213_464_1264 259
99 3300048915 Ga0496112_0005097 Ga0496112_0005097_7476_8342 259
100 3300048916 Ga0496113_0129743 Ga0496113_0129743_1081_1947 259
101 3300059504 Ga0587082_007733 Ga0587082_007733_257_1039 259
102 3300059505 Ga0587083_0009491 Ga0587083_0009491_533_1315 259
103 3300003751 Ga0055538_1000667 Ga0055538_10006679 260
104 3300005339 Ga0070660_100170490 Ga0070660_1001704902 260
105 3300005366 Ga0070659_100150799 Ga0070659_1001507992 260
106 3300005458 Ga0070681_10443482 Ga0070681_104434822 260
107 3300005535 Ga0070684_100386513 Ga0070684_1003865132 260
108 3300005614 Ga0068856_100006560 Ga0068856_1000065607 260
109 3300006175 Ga0070712_100109345 Ga0070712_1001093452 260
110 3300013102 Ga0157371_10014448 Ga0157371_100144485 260
111 3300013104 Ga0157370_10079486 Ga0157370_100794862 260
112 3300013296 Ga0157374_10038825 Ga0157374_100388253 260
113 3300013307 Ga0157372_10550398 Ga0157372_105503981 260
114 3300025224 Ga0209784_100109 Ga0209784_10010925 260
115 3300025921 Ga0207652_10213948 Ga0207652_102139482 260
116 3300025932 Ga0207690_10116974 Ga0207690_101169742 260
117 3300039437 Ga0436365_0902199 Ga0436365_0902199_482_1312 260
118 3300039453 Ga0436362_0399414 Ga0436362_0399414_1219_2037 260
119 3300048915 Ga0496112_0143000 Ga0496112_0143000_509_1306 260
120 3300003320 rootH2_10164433 rootH2_101644332 261
121 3300006844 Ga0075428_100091644 Ga0075428_1000916443 261
122 3300049570 Ga0501033_0132423 Ga0501033_0132423_17_859 261
123 3300049571 Ga0501034_0005780 Ga0501034_0005780_5097_5939 261
124 3300049580 Ga0501046_0175383 Ga0501046_0175383_574_1416 261
125 3300049581 Ga0501047_0016123 Ga0501047_0016123_76_918 261
126 3300049581 Ga0501047_0124895 Ga0501047_0124895_574_1401 261
127 3300049586 Ga0501070_0047673 Ga0501070_0047673_284_1126 261
128 3300049586 Ga0501070_0050480 Ga0501070_0050480_1073_1900 261
129 3300049589 Ga0501073_0105978 Ga0501073_0105978_905_1732 261
130 3300049822 Ga0501035_0010559 Ga0501035_0010559_227_1069 261
131 3300049822 Ga0501035_0204035 Ga0501035_0204035_607_1434 261
132 3300049823 Ga0501044_0002458 Ga0501044_0002458_8298_9125 261
133 3300049823 Ga0501044_0026855 Ga0501044_0026855_4219_5061 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01182

Glucosamine_iso

Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

55

194

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lqn-assembly2.cif.gz_I glucosamine-6-phosphate deaminase from h. influenzae 0.9037 23 259
2ri0-assembly2.cif.gz_B crystal structure of glucosamine 6-phosphate deaminase (nagb) from s. mutans 0.896 17 255
2bkv-assembly1.cif.gz_A structure and kinetics of a monomeric glucosamine-6-phosphate deaminase: missing link of the nagb superfamily 0.8916 19 255
1ne7-assembly1.cif.gz_E human glucosamine-6-phosphate deaminase isomerase at 1.75 a resolution complexed with n-acetyl-glucosamine-6-phosphate and 2-deoxy-2-amino-glucitol-6-phosphate 0.888 19 259
1cd5-assembly1.cif.gz_A glucosamine-6-phosphate deaminase from e.coli, t conformer 0.8844 23 258
ID Description Score Start End Superfamily
af_Q54M58_36_296_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9088 19 258 3.40.50.1360
2ri0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.896 17 255 3.40.50.1360
af_M0RCH5_1_250_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8951 56 259 3.40.50.1360
af_Q04802_1_247_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8931 19 259 3.40.50.1360
2bkxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8883 19 257 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A7C4XY82-F1-model_v4 Glucosamine-6-phosphate deaminase 0.9804 9 259 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-A0A255E2L4-F1-model_v4 Glucosamine-6-phosphate deaminase 0.9798 10 259 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-A0A2V7XZE7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9795 10 258 GO:0005975
AF-A0A7Y5LFJ4-F1-model_v4 6-phosphogluconolactonase 0.9791 11 258 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-A0A7S7NP25-F1-model_v4 6-phosphogluconolactonase 0.9782 10 259 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802

Feature Viewer

pLDDT pTM Quality
92.68 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map