F154400

General Info

Members Datasets Scaffolds Average Seq Length
132 91 124 300

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0014998|Ga0500559_0014998_864_1907
Length 347
Sequence MVNQKNLHFGYNISSFCYPFFLVLVEFCSIKKSTMKITITGSLGNISKPLTKELVEKGHSVTVISSKSDKQKAIEALGATAAIGSIEDVDFLISAFTGADAVYCMIPLIFSEPDLPAYMRRIANNYLQALKQTKIKHVVVLSGWAADLISGENAEDIFNELTNVSITIMRPGAFYSNFYSSMDLIRGKGLPGAFLTLRYSGIMALLRGRRGLLMGNYGGDDKIVFVSPIDIADAVAEELLTVTESTKIRYVGSEEMTCNEAAGIIGAAIGKPYLKWVLLSDKQMLQGLKMAKVPLKLAELLVEMQAANHSGVPLRNFHKNNPKMGIVKFKDFAKEFAEAYNKKYLSL

Samples

Sample ID Description Type Environment
1 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
2 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
5 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
6 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
7 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
8 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
9 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
79 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
80 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
85 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
86 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
87 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
88 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
89 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
90 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
91 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.18
Metatranscriptomes 0
Isolates 6.82

Biome Distribution

Category Percentage (%)
Aerial Root 1.52
Bulb 0
Endosphere 12.88
Nodule 0
Rhizoplane 0
Rhizosphere 65.91
Stem 0
Stem Tuber 0
Unclassified 19.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10029349 3300003203 Bacteria 2083
2 rootH1_10069888 3300003316 Bacteria 8880
3 rootH2_10005827 3300003320 Bacteria 117906
4 rootH2_10108475 3300003320 Bacteria 2408
5 rootH2_10115097 3300003320 Bacteria 2683
6 rootH2_10131660 3300003320 Bacteria 2942
7 rootH2_10205209 3300003320 Bacteria 2457
8 rootL2_10009417 3300003322 Bacteria 8612
9 rootL2_10080136 3300003322 Bacteria 2563
10 rootL2_10082053 3300003322 Bacteria 4212
11 rootL2_10082331 3300003322 Bacteria 3000
12 rootH1_10007039 3300003316 Bacteria 6515
13 rootH1_10007039 3300003323 Bacteria 2486
14 rootH1_10009799 3300003323 Bacteria 7505
15 rootH1_10056178 3300003323 Bacteria 16455
16 rootH1_10097910 3300003323 Bacteria 12830
17 rootH1_10230167 3300003323 Bacteria 3006
18 rootH1_10241299 3300003323 Bacteria 2293
19 rootH1_10345308 3300003323 Bacteria 3017
20 JGI25160J50197_1003732 3300003354 Bacteria 6713
21 Ga0055535_1004551 3300003761 Bacteria 3333
22 Ga0055542_1008734 3300003762 Bacteria 1961
23 Ga0055531_10000030 3300003794 Bacteria 157459
24 Ga0065165_1040120 3300005262 Bacteria 1398
25 Ga0065715_10105755 3300005293 Bacteria 2873
26 Ga0070683_100001512 3300005329 Bacteria 17964
27 Ga0070666_10199883 3300005335 Bacteria 1406
28 Ga0070671_100004435 3300005355 Bacteria 11107
29 Ga0070681_10036661 3300005458 Bacteria 4923
30 Ga0070679_100181100 3300005530 Bacteria 2079
31 Ga0070684_100001536 3300005535 Bacteria 16699
32 Ga0068853_100102252 3300005539 Bacteria 2535
33 Ga0068853_100637464 3300005539 Unclassified 1014
34 Ga0070665_100000284 3300005548 Bacteria 82062
35 Ga0068855_100018067 3300005563 Bacteria 8475
36 Ga0068864_100545829 3300005618 Bacteria 1120
37 Ga0068863_100550633 3300005841 Bacteria 1139
38 Ga0081539_10001245 3300005985 Bacteria 45262
39 Ga0105240_10020938 3300009093 Bacteria 8706
40 Ga0105243_10073871 3300009148 Bacteria 2764
41 Ga0105241_10273684 3300009174 Bacteria 1439
42 Ga0105239_10039851 3300010375 Bacteria 5146
43 Ga0105239_10210995 3300010375 Bacteria 2177
44 Ga0105246_10045883 3300011119 Bacteria 2979
45 Ga0157371_10025169 3300013102 Bacteria 4340
46 Ga0157371_10060222 3300013102 Bacteria 2692
47 Ga0157370_10218127 3300013104 Bacteria 1767
48 Ga0163162_10000044 3300013306 Bacteria 128200
49 Ga0157372_10078550 3300013307 Bacteria 3729
50 Ga0157372_10550294 3300013307 Bacteria 1345
51 Ga0157375_10940107 3300013308 Bacteria 1007
52 Ga0157379_10043012 3300014968 Bacteria 4034
53 Ga0157376_10049647 3300014969 Bacteria 3477
54 Ga0209258_100036 3300025242 Bacteria 428859
55 Ga0209646_1002384 3300025246 Bacteria 4205
56 Ga0209148_1000230 3300025254 Bacteria 91940
57 Ga0207426_1000157 3300025302 Bacteria 178442
58 Ga0209257_1000013 3300025304 Bacteria 1047305
59 Ga0207654_10276959 3300025911 Bacteria 1133
60 Ga0207707_10077184 3300025912 Bacteria 2908
61 Ga0207695_10002635 3300025913 Bacteria 26250
62 Ga0207652_10586332 3300025921 Bacteria 1001
63 Ga0207709_10073395 3300025935 Bacteria 2180
64 Ga0207661_10202544 3300025944 Bacteria 1745
65 Ga0207667_10025749 3300025949 Bacteria 6435
66 Ga0207641_10524064 3300026088 Bacteria 1153
67 Ga0268266_10000291 3300028379 Bacteria 82093
68 Ga0265334_10036052 3300028573 Bacteria 1954
69 Ga0307509_10140828 3300031507 Bacteria 2348
70 Ga0395899_0000177 3300037312 Bacteria 94226
71 Ga0395900_0015898 3300037418 Bacteria 7666
72 Ga0395905_0055260 3300037471 Bacteria 3716
73 Ga0395901_0169465 3300038443 Bacteria 2291
74 Ga0439447_000827 3300041407 Bacteria 11348
75 Ga0466969_0032953 3300044656 Bacteria 2633
76 Ga0466972_0000235 3300044658 Bacteria 38259
77 Ga0466972_0002857 3300044658 Bacteria 8552
78 Ga0466972_0005859 3300044658 Bacteria 6161
79 Ga0466965_0023799 3300044683 Bacteria 2959
80 Ga0466966_0000014 3300044684 Bacteria 127891
81 Ga0466966_0004466 3300044684 Bacteria 9224
82 Ga0466966_0011308 3300044684 Bacteria 5920
83 Ga0466966_0015812 3300044684 Bacteria 4986
84 Ga0466961_0004688 3300044693 Bacteria 8592
85 Ga0466961_0050999 3300044693 Bacteria 2643
86 Ga0466961_0073979 3300044693 Bacteria 2160
87 Ga0466961_0106956 3300044693 Bacteria 1761
88 Ga0466964_0012685 3300044706 Bacteria 3190
89 Ga0466964_0025562 3300044706 Unclassified 2306
90 Ga0466964_0070340 3300044706 Unclassified 1478
91 Ga0466968_0003113 3300044735 Bacteria 6122
92 Ga0466968_0009531 3300044735 Bacteria 3736
93 Ga0466970_0028608 3300044765 Bacteria 2930
94 Ga0466970_0037972 3300044765 Bacteria 2554
95 Ga0466957_0001027 3300044842 Bacteria 14399
96 Ga0466957_0018599 3300044842 Bacteria 4081
97 Ga0466957_0026577 3300044842 Bacteria 3435
98 Ga0466960_0009625 3300044901 Bacteria 3990
99 Ga0466960_0218380 3300044901 Unclassified 1048
100 Ga0466959_0000011 3300045049 Bacteria 173387
101 Ga0466959_0002903 3300045049 Bacteria 11057
102 Ga0466959_0055694 3300045049 Bacteria 2886
103 Ga0495606_0000426 3300046507 Bacteria 70066
104 Ga0495606_0013090 3300046507 Bacteria 6589
105 Ga0495654_0055766 3300046530 Bacteria 1912
106 Ga0495660_0009167 3300046810 Bacteria 5780
107 Ga0495686_0000095 3300047472 Bacteria 184643
108 Ga0495686_0001245 3300047472 Bacteria 29041
109 Ga0495686_0001299 3300047472 Bacteria 28153
110 Ga0496121_0000043 3300048924 Bacteria 341882
111 Ga0496126_0014030 3300048929 Bacteria 8121
112 Ga0496126_0017129 3300048929 Bacteria 7226
113 Ga0501070_0096963 3300049586 Bacteria 2439
114 Ga0501224_015697 3300049664 Bacteria 1122
115 Ga0500583_0027619 3300053092 Unclassified 2452
116 Ga0500607_035693 3300053121 Bacteria 2718
117 Ga0500618_000026 3300053125 Bacteria 148672
118 Ga0500559_0014998 3300053136 Bacteria 3276
119 Ga0500622_0000004 3300053156 Bacteria 557587
120 Ga0500622_0000005 3300053156 Bacteria 502443
121 Ga0500622_0000301 3300053156 Bacteria 50446
122 Ga0500661_005838 3300055283 Bacteria 2293
123 Ga0466962_0018868 3300061719 Bacteria 3314
124 Ga0466962_0054562 3300061719 Bacteria 1909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10036661 Ga0070681_100366615 280
2 3300025912 Ga0207707_10077184 Ga0207707_100771842 280
3 3300048924 Ga0496121_0000043 Ga0496121_0000043_304060_304911 283
4 3300003322 rootL2_10009417 rootL2_100094172 284
5 3300003323 rootH1_10097910 rootH1_100979106 284
6 3300003323 rootH1_10345308 rootH1_103453083 284
7 3300010375 Ga0105239_10210995 Ga0105239_102109952 284
8 3300048929 Ga0496126_0017129 Ga0496126_0017129_3382_4299 284
9 3300003323 rootH1_10009799 rootH1_100097993 285
10 3300055283 Ga0500661_005838 Ga0500661_005838_1143_2066 285
11 3300003761 Ga0055535_1004551 Ga0055535_10045514 287
12 3300003762 Ga0055542_1008734 Ga0055542_10087342 287
13 3300025242 Ga0209258_100036 Ga0209258_10003610 287
14 3300025254 Ga0209148_1000230 Ga0209148_100023037 287
15 3300028573 Ga0265334_10036052 Ga0265334_100360522 287
16 3300047472 Ga0495686_0001299 Ga0495686_0001299_863_1792 287
17 3300053092 Ga0500583_0027619 Ga0500583_0027619_1307_2248 287
18 3300053121 Ga0500607_035693 Ga0500607_035693_318_1259 287
19 3300053125 Ga0500618_000026 Ga0500618_000026_26384_27322 287
20 3300053136 Ga0500559_0014998 Ga0500559_0014998_864_1907 287
21 iso_pu_bacteria 2821136567 2821139028 288
22 iso_pu_bacteria 2881247448 2881248516 288
23 iso_pu_bacteria 2904467357 2904472452 288
24 iso_pu_bacteria 2984572630 2984573462 288
25 iso_pu_bacteria 2984606641 2984606901 288
26 3300005530 Ga0070679_100181100 Ga0070679_1001811001 289
27 3300013102 Ga0157371_10060222 Ga0157371_100602221 289
28 3300013307 Ga0157372_10550294 Ga0157372_105502942 289
29 3300025921 Ga0207652_10586332 Ga0207652_105863321 289
30 3300049586 Ga0501070_0096963 Ga0501070_0096963_1199_2089 289
31 3300047472 Ga0495686_0001245 Ga0495686_0001245_13603_14475 290
32 3300053156 Ga0500622_0000005 Ga0500622_0000005_169280_170179 290
33 3300003323 rootH1_10230167 rootH1_102301676 291
34 3300025911 Ga0207654_10276959 Ga0207654_102769592 291
35 3300037312 Ga0395899_0000177 Ga0395899_0000177_77923_78798 291
36 3300046507 Ga0495606_0000426 Ga0495606_0000426_15099_16001 291
37 iso_pu_bacteria 2965320100 2965321257 291
38 3300003354 JGI25160J50197_1003732 JGI25160J50197_10037326 292
39 3300003794 Ga0055531_10000030 Ga0055531_1000003078 292
40 3300005618 Ga0068864_100545829 Ga0068864_1005458291 292
41 3300013104 Ga0157370_10218127 Ga0157370_102181272 292
42 3300025302 Ga0207426_1000157 Ga0207426_100015773 292
43 3300025304 Ga0209257_1000013 Ga0209257_1000013387 292
44 3300048929 Ga0496126_0014030 Ga0496126_0014030_799_1677 292
45 3300049664 Ga0501224_015697 Ga0501224_015697_23_958 292
46 3300005329 Ga0070683_100001512 Ga0070683_1000015122 293
47 3300005535 Ga0070684_100001536 Ga0070684_10000153613 293
48 3300025944 Ga0207661_10202544 Ga0207661_102025442 293
49 3300046810 Ga0495660_0009167 Ga0495660_0009167_3016_3900 293
50 3300047472 Ga0495686_0000095 Ga0495686_0000095_65186_66070 293
51 iso_pu_bacteria 2739367857 2740002203 293
52 iso_pu_bacteria 2739367858 2740007019 293
53 3300003320 rootH2_10005827 rootH2_1000582742 294
54 3300003320 rootH2_10205209 rootH2_102052092 294
55 3300003322 rootL2_10082331 rootL2_100823311 294
56 3300003323 rootH1_10007039 rootH1_100070394 294
57 3300003323 rootH1_10241299 rootH1_102412991 294
58 3300005262 Ga0065165_1040120 Ga0065165_10401202 294
59 3300005355 Ga0070671_100004435 Ga0070671_1000044354 294
60 3300005539 Ga0068853_100102252 Ga0068853_1001022522 294
61 3300005539 Ga0068853_100637464 Ga0068853_1006374641 294
62 3300005548 Ga0070665_100000284 Ga0070665_10000028423 294
63 3300005563 Ga0068855_100018067 Ga0068855_1000180676 294
64 3300009093 Ga0105240_10020938 Ga0105240_100209388 294
65 3300009148 Ga0105243_10073871 Ga0105243_100738714 294
66 3300011119 Ga0105246_10045883 Ga0105246_100458832 294
67 3300013306 Ga0163162_10000044 Ga0163162_1000004432 294
68 3300013307 Ga0157372_10078550 Ga0157372_100785504 294
69 3300013308 Ga0157375_10940107 Ga0157375_109401071 294
70 3300025913 Ga0207695_10002635 Ga0207695_1000263519 294
71 3300025935 Ga0207709_10073395 Ga0207709_100733953 294
72 3300025949 Ga0207667_10025749 Ga0207667_100257496 294
73 3300028379 Ga0268266_10000291 Ga0268266_1000029122 294
74 3300003320 rootH2_10115097 rootH2_101150972 295
75 3300003323 rootH1_10056178 rootH1_1005617810 295
76 3300014968 Ga0157379_10043012 Ga0157379_100430124 295
77 3300014969 Ga0157376_10049647 Ga0157376_100496473 295
78 3300053156 Ga0500622_0000301 Ga0500622_0000301_24198_25085 295
79 3300003320 rootH2_10131660 rootH2_101316604 296
80 3300010375 Ga0105239_10039851 Ga0105239_100398513 296
81 iso_pu_bacteria 2889290771 2889291721 296
82 3300003316 rootH1_10069888 rootH1_1006988813 297
83 3300003322 rootL2_10080136 rootL2_100801363 297
84 3300005293 Ga0065715_10105755 Ga0065715_101057553 297
85 3300005335 Ga0070666_10199883 Ga0070666_101998832 297
86 3300009174 Ga0105241_10273684 Ga0105241_102736841 297
87 3300031507 Ga0307509_10140828 Ga0307509_101408282 297
88 3300041407 Ga0439447_000827 Ga0439447_000827_10408_11316 297
89 3300046507 Ga0495606_0013090 Ga0495606_0013090_1962_2924 297
90 3300046530 Ga0495654_0055766 Ga0495654_0055766_546_1454 297
91 3300013102 Ga0157371_10025169 Ga0157371_100251692 298
92 3300053156 Ga0500622_0000004 Ga0500622_0000004_229884_230780 298
93 3300005841 Ga0068863_100550633 Ga0068863_1005506332 300
94 3300026088 Ga0207641_10524064 Ga0207641_105240642 300
95 3300037418 Ga0395900_0015898 Ga0395900_0015898_6038_6943 301
96 3300037471 Ga0395905_0055260 Ga0395905_0055260_1400_2305 301
97 3300038443 Ga0395901_0169465 Ga0395901_0169465_524_1429 301
98 3300044658 Ga0466972_0002857 Ga0466972_0002857_7078_7983 301
99 3300044684 Ga0466966_0004466 Ga0466966_0004466_5356_6261 301
100 3300044684 Ga0466966_0011308 Ga0466966_0011308_3640_4659 301
101 3300044693 Ga0466961_0004688 Ga0466961_0004688_1855_2874 301
102 3300044693 Ga0466961_0073979 Ga0466961_0073979_985_1890 301
103 3300044706 Ga0466964_0025562 Ga0466964_0025562_570_1475 301
104 3300044735 Ga0466968_0003113 Ga0466968_0003113_2776_3681 301
105 3300044842 Ga0466957_0018599 Ga0466957_0018599_842_1747 301
106 3300044901 Ga0466960_0218380 Ga0466960_0218380_92_997 301
107 3300045049 Ga0466959_0002903 Ga0466959_0002903_5278_6183 301
108 3300003203 JGI25406J46586_10029349 JGI25406J46586_100293492 302
109 3300003320 rootH2_10108475 rootH2_101084753 302
110 3300003322 rootL2_10082053 rootL2_100820534 302
111 3300005985 Ga0081539_10001245 Ga0081539_1000124511 302
112 3300025246 Ga0209646_1002384 Ga0209646_10023842 302
113 3300044656 Ga0466969_0032953 Ga0466969_0032953_535_1446 302
114 3300044658 Ga0466972_0000235 Ga0466972_0000235_33382_34293 302
115 3300044658 Ga0466972_0005859 Ga0466972_0005859_3154_4065 302
116 3300044683 Ga0466965_0023799 Ga0466965_0023799_766_1677 302
117 3300044684 Ga0466966_0000014 Ga0466966_0000014_21557_22468 302
118 3300044684 Ga0466966_0015812 Ga0466966_0015812_3772_4680 302
119 3300044693 Ga0466961_0050999 Ga0466961_0050999_845_1756 302
120 3300044693 Ga0466961_0106956 Ga0466961_0106956_556_1464 302
121 3300044706 Ga0466964_0012685 Ga0466964_0012685_1969_2880 302
122 3300044706 Ga0466964_0070340 Ga0466964_0070340_462_1373 302
123 3300044735 Ga0466968_0009531 Ga0466968_0009531_822_1733 302
124 3300044765 Ga0466970_0028608 Ga0466970_0028608_1740_2648 302
125 3300044765 Ga0466970_0037972 Ga0466970_0037972_802_1713 302
126 3300044842 Ga0466957_0001027 Ga0466957_0001027_12026_12937 302
127 3300044842 Ga0466957_0026577 Ga0466957_0026577_719_1630 302
128 3300044901 Ga0466960_0009625 Ga0466960_0009625_204_1115 302
129 3300045049 Ga0466959_0000011 Ga0466959_0000011_130860_131771 302
130 3300045049 Ga0466959_0055694 Ga0466959_0055694_249_1157 302
131 3300061719 Ga0466962_0018868 Ga0466962_0018868_1310_2221 302
132 3300061719 Ga0466962_0054562 Ga0466962_0054562_178_1089 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13460

NAD_binding_10

NAD(P)H-binding

41

190

0.88

PF05368

NmrA

NmrA-like family

37

331

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rfq-assembly1.cif.gz_E cryo-em structure of a respiratory complex i assembly intermediate with ndufaf2 0.8774 2 223
7r48-assembly1.cif.gz_P bovine complex i in the presence of im1761092, deactive class iv (composite map) 0.855 1 229
7v2f-assembly1.cif.gz_J deactive state complex i from q10-nadh dataset 0.8521 1 229
2zcv-assembly1.cif.gz_A crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli 0.8512 3 295
6zr2-assembly1.cif.gz_P cryo-em structure of respiratory complex i in the active state from mus musculus at 3.1 a 0.8511 2 262
ID Description Score Start End Superfamily
5xgvB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9021 2 34 3.50.50.60
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8975 2 35 3.50.50.60
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.894 2 35 3.50.50.60
2zcuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8614 3 147 3.40.50.720
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8594 1 34 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A4Q3HH83-F1-model_v4 deleted 0.9821 1 302
AF-A0A316AQ84-F1-model_v4 Uncharacterized protein YbjT (DUF2867 family) 0.982 1 302
AF-A0A4Q3HH83-F1-model_v4 deleted 0.9789 1 302
AF-A0A519X652-F1-model_v4 NAD-dependent dehydratase 0.9753 1 261
AF-A0A4V6KTI3-F1-model_v4 NADH-flavin reductase 0.9718 1 302

Feature Viewer

pLDDT pTM Quality
96.31 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map